Recombinant Full Length Drosophila Melanogaster Band 7 Protein Cg42540(Cg42540) Protein, His-Tagged
Cat.No. : | RFL8218DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Band 7 protein CG42540(CG42540) Protein (Q9VZA4) (1-505aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-505) |
Form : | Lyophilized powder |
AA Sequence : | MPDSMMDMEHRDHQLHRQQQQSHHHQPPRLTASTSTFAPPAPAGSQSEERDRDRDRERDH HLHHHQSNNVASSPLPVTASIQLHQQQPQQQQQQQPLTQLQQPQLREREHHQQQQQQQQQ MMQQPQQQQQMQQPQQQLPHSHHALMQQSQQQQAIHRAEARRADEEISDKASTCGKLLIF LSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDL RTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMG TRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAARE ARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLI TYFLKTNEATTQQNARAAAAAIGNTPPPLQLAPQQQMGQQQQPQYQQPQQQQQQYQPQQQ QQQQQQQPQQQDQLYQQGQQISSAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG42540 |
Synonyms | CG42540; Band 7 protein CG42540 |
UniProt ID | Q9VZA4 |
◆ Recombinant Proteins | ||
TAS2R134-16459M | Recombinant Mouse TAS2R134 Protein | +Inquiry |
VLP-350S | Recombinant SARS-CoV-2 (B.1.617.2, Delta) Virus-Like Particles | +Inquiry |
ARHGEF1-27183TH | Recombinant Human ARHGEF1, His-tagged | +Inquiry |
RFL6501CF | Recombinant Full Length Candida Tropicalis Cytochrome B5(Cytb5) Protein, His-Tagged | +Inquiry |
GSX1-3371HF | Recombinant Full Length Human GSX1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIPPLY1-544HCL | Recombinant Human RIPPLY1 lysate | +Inquiry |
Kidney-260H | Human Kidney Liver Cirrhosis Lysate | +Inquiry |
TLL1-1786HCL | Recombinant Human TLL1 cell lysate | +Inquiry |
MEP1A-2166HCL | Recombinant Human MEP1A cell lysate | +Inquiry |
PLBD2-922HCL | Recombinant Human PLBD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG42540 Products
Required fields are marked with *
My Review for All CG42540 Products
Required fields are marked with *
0
Inquiry Basket