Recombinant Full Length Dopamine Receptor 3(Dop-3) Protein, His-Tagged
Cat.No. : | RFL15564CF |
Product Overview : | Recombinant Full Length Dopamine receptor 3(dop-3) Protein (Q61H86) (1-604aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-604) |
Form : | Lyophilized powder |
AA Sequence : | MLTGQHHIPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLI VSLAVSDLFVAIGVMSFGVYYEWNGFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLLGVNPMENDQCELANPWFNMI SSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK HFKNRTDQILLEISFQTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPE CGSMPNLTIIERPAPPEKEKDIELSIMDLHDTVEMLDDKYTSAMITRSFGEELEEILPFI DGSTSVKNSREQLHATRSNTSTTRLLDVKPELRSISVPSIQDEKKMNSRPPENPFAHQNG TNKQRLLPNPGILMKSKSTTLLKTNGYLDTDSLNNNRNSHKKSTADLLPNDDYSFTDSMR VYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFI LHLSNSICLVIDSNSDCIGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGF FKKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dop-3 |
Synonyms | dop-3; CBG10841; Dopamine receptor 3 |
UniProt ID | Q61H86 |
◆ Recombinant Proteins | ||
ANKS3-30147H | Recombinant Human ANKS3 protein, GST-tagged | +Inquiry |
Ror1-192MA | Recombinant Mouse Ror1 protein, Fc-tagged, APC labeled | +Inquiry |
CR1L-1953M | Recombinant Mouse CR1L Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33809HF | Recombinant Full Length Human Olfactory Receptor 5M8(Or5M8) Protein, His-Tagged | +Inquiry |
RAG1-7400M | Recombinant Mouse RAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
TLN1-890T | Native Turkey TLN1 Protein | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
Complement C3a-46H | Native Human Complement C3a | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELSPBP1-6614HCL | Recombinant Human ELSPBP1 293 Cell Lysate | +Inquiry |
EXOSC2-6503HCL | Recombinant Human EXOSC2 293 Cell Lysate | +Inquiry |
C1orf115-8185HCL | Recombinant Human C1orf115 293 Cell Lysate | +Inquiry |
NFYA-3840HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
RHBDL3-2359HCL | Recombinant Human RHBDL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dop-3 Products
Required fields are marked with *
My Review for All dop-3 Products
Required fields are marked with *
0
Inquiry Basket