Recombinant Full Length Dictyostelium Discoideum Uncharacterized Transmembrane Protein Ddb_G0284909(Ddb_G0284909) Protein, His-Tagged
Cat.No. : | RFL22025DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0284909(DDB_G0284909) Protein (Q54NZ2) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MKLKINIRPNEIIFLICIVVIFSFSYTLTYFDSPIFKEHYITNNGNDFGVENHFVTYHST YKEDIHKRIIDPHHGLIQEITKTFYPVSSPLEKLFSFSDNILIVLIIVQVIVGFLIFLLS VEKLSKCNYQLKSIFSTKSTFYINNNNNNNNEDINNNNNNNNNNNNKNKNDERNNEEIED EETIRKEKILIIKKKRDILLAIIIFFLVLLGVLTIIYVSFIPLNIRKAFIGQQFYYKGSI DPLCADISNEGDHHIGKCKSLNGRIGNVNDKIFGYSWSLDSGLFNVKIVFFSTILIEFLT GCLILLMKFKKDPNIVPLTKPSIASPTQIPHLFCIAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0284909 |
Synonyms | DDB_G0284909; Uncharacterized transmembrane protein DDB_G0284909 |
UniProt ID | Q54NZ2 |
◆ Recombinant Proteins | ||
ALPK3-493H | Recombinant Human ALPK3 Protein, GST-tagged | +Inquiry |
YQAI-3088B | Recombinant Bacillus subtilis YQAI protein, His-tagged | +Inquiry |
PLSCR1-354H | Recombinant Human phospholipid scramblase 1, His-tagged | +Inquiry |
FAAH-2183R | Recombinant Rat FAAH Protein | +Inquiry |
SAP111A-005-2051S | Recombinant Staphylococcus aureus (strain: WBG8366, other: ST78-MRSA-IVa (2B)) SAP111A_005 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TG-121B | Native Bovine TG | +Inquiry |
Collagen Type III-07H | Native Human Collagen Type III | +Inquiry |
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
CAT-15A | Active Native Aspergillus Niger Catalase | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RX1-464HCL | Recombinant Human P2RX1 lysate | +Inquiry |
MYCL1-4037HCL | Recombinant Human MYCL1 293 Cell Lysate | +Inquiry |
SWAP70-1325HCL | Recombinant Human SWAP70 293 Cell Lysate | +Inquiry |
RAG2-2547HCL | Recombinant Human RAG2 293 Cell Lysate | +Inquiry |
CCHCR1-167HCL | Recombinant Human CCHCR1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DDB_G0284909 Products
Required fields are marked with *
My Review for All DDB_G0284909 Products
Required fields are marked with *
0
Inquiry Basket