Recombinant Human ALPK3 Protein, GST-tagged

• Cat.No.: ALPK3-493H
• Product Overview: Human ALPK3 partial ORF ( NP_065829, 1811 a.a. - 1906 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ALPK3 (Alpha Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity. An important paralog of this gene is ALPK2.
• Molecular Mass: 36.3 kDa
• AA Sequence: SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALPK3 alpha-kinase 3 [ Homo sapiens ]
• Official Symbol: ALPK3
• Synonyms: ALPK3; alpha-kinase 3; alpha-protein kinase 3; KIAA1330; MAK; Midori; muscle alpha kinase; myocyte induction differentiation originator; muscle alpha-kinase; muscle alpha-protein kinase; MIDORI; FLJ12881; FLJ21176
• Gene ID: 57538
• mRNA Refseq: NM_020778
• Protein Refseq: NP_065829
• UniProt ID: Q96L96