Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein Ddb_G0273707/Ddb_G0273361(Ddb_G0273707) Protein, His-Tagged
Cat.No. : | RFL32111DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Transmembrane protein DDB_G0273707/DDB_G0273361(DDB_G0273707) Protein (Q556Z9) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MNEIEVDNLSHTNKNVATDNINNNNNDIELETIPNDSNNSNNNNNNNNNNNNNNNNNNNN NNNSNSNDIELETEPNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNENNNKIKNEK INILLSIKLYFIQYFKKWKGGEKSPVRADLEEIGWSWLSSFIGILVLALLHYRVTVEKET IFLLGSFAASAVLIFGAPKSPLAQPRNLVLGHIVSATVGSIIRVALVYTNAQTEVACALA VSLAIVGMHFTKSIHPPGGATALICVMSAEQRWRGFYYIFVPVASGSLTMLLTALIVNNF ARKRKYPVFWW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0273707; |
Synonyms | DDB_G0273707; DDB_G0273361; Transmembrane protein DDB_G0273707/DDB_G0273361 |
UniProt ID | Q556Z9 |
◆ Native Proteins | ||
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2C-592HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
PIN1-3179HCL | Recombinant Human PIN1 293 Cell Lysate | +Inquiry |
ZNF688-28HCL | Recombinant Human ZNF688 293 Cell Lysate | +Inquiry |
ME1-4401HCL | Recombinant Human ME1 293 Cell Lysate | +Inquiry |
PAX5-3416HCL | Recombinant Human PAX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DDB_G0273707; Products
Required fields are marked with *
My Review for All DDB_G0273707; Products
Required fields are marked with *
0
Inquiry Basket