Recombinant Full Length Dictyostelium Discoideum Sideroflexin(Sfxn) Protein, His-Tagged
Cat.No. : | RFL22020DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Sideroflexin(sfxn) Protein (Q54NQ9) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MTSNSFPVFDGVSNKYDNNTFYGRYQNFRDITDPSTLFATEKDLSQSKTLLDNFKKGLVD PVKHSDELWKAKKILDSTIHPDTGKPIFLPFRVSAFLPINVIICAGLILPNASIGTTIFW QWINQSYNIALNHANRNASNTMSNKQILEAYASAVGISCSLAVGLGWGVNKLNIQNKTIS SALRMMVPFTAVTSAGIANVLIMRGNEMVNGIDIKDKDGVIHGKSKEAGKSAVYKVAFSR AATSFPALLLPPIVMGLFERTSFVKKYPKVRMPLNLAVIAAIFNTSLPAAIALFPQESTI SADSLEPQFRNIKDKNGNIIKEFIYNKGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sfxn |
Synonyms | sfxn; DDB_G0285029; Sideroflexin |
UniProt ID | Q54NQ9 |
◆ Recombinant Proteins | ||
SPG11-2914H | Recombinant Human SPG11, GST-tagged | +Inquiry |
EFS-4238HF | Recombinant Full Length Human EFS Protein, GST-tagged | +Inquiry |
SUB1-3541H | Recombinant Human SUB1 protein, His-SUMO-tagged | +Inquiry |
VTCN1-1518R | Recombinant Rhesus Monkey VTCN1 Protein, hIgG4-tagged | +Inquiry |
TMED7-12165Z | Recombinant Zebrafish TMED7 | +Inquiry |
◆ Native Proteins | ||
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
VLDL-392H | Native Human Very Low Density Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM116A-6447HCL | Recombinant Human FAM116A 293 Cell Lysate | +Inquiry |
HSPB11-5350HCL | Recombinant Human HSPB11 293 Cell Lysate | +Inquiry |
CSF2RB-1137RCL | Recombinant Rat CSF2RB cell lysate | +Inquiry |
PBX1-3408HCL | Recombinant Human PBX1 293 Cell Lysate | +Inquiry |
IL4I1-5225HCL | Recombinant Human IL4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sfxn Products
Required fields are marked with *
My Review for All sfxn Products
Required fields are marked with *
0
Inquiry Basket