Recombinant Human SUB1 protein, His-SUMO-tagged

• Cat.No.: SUB1-3541H
• Product Overview: Recombinant Human SUB1 protein(P53999)(2-127aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-127aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.3 kDa
• AA Sequence: PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SUB1 SUB1 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUB1
• Synonyms: SUB1; SUB1 homolog (S. cerevisiae); activated RNA polymerase II transcriptional coactivator p15; p14; p15; PC4; positive cofactor 4; activated RNA polymerase II transcription cofactor 4; P15; MGC102747
• Gene ID: 10923
• mRNA Refseq: NM_006713
• Protein Refseq: NP_006704
• MIM: 600503
• UniProt ID: P53999