Recombinant Full Length Dictyostelium Discoideum Putative Lysophosphatidylcholine Acyltransferase(Taz) Protein, His-Tagged
Cat.No. : | RFL2542DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative lysophosphatidylcholine acyltransferase(taz) Protein (Q54DX7) (1-285aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-285) |
Form : | Lyophilized powder |
AA Sequence : | MDSNNSNNNNKNLKQICDIPKPQFLSKGVFTLVGVLCKFWISMNTVTTSGIDKLVNEIDK THQLKRPMITIANHSSNLDDPLLWGVLPNRILMDPSKQRWTLGASNILFTNWFYSKFFSL GKCIKIVRGDGIYQDGMNESIDRLSEGQWLHIFPEGRISQQTQLLYFKWGLGRLVGECYR RTGVVPLVVPIYHQGMEKSMPLAKLPIPRVGINLDIKVGDNIYCDQVISKYIDDNKISDL TDYLSQDDKKRKDFYKTITLHIEDEYQKIIPPTNRGRFSHPTIKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | taz |
Synonyms | taz; DDB_G0291922; Taffazin; Taz; 1-acylglycerophosphocholine O-acyltransferase |
UniProt ID | Q54DX7 |
◆ Recombinant Proteins | ||
HLA-G&B2M-392HB | Recombinant Human HLA-G&B2M Protein, His-Avi-tagged, Biotinylated | +Inquiry |
ABHD16B-18R | Recombinant Rhesus Macaque ABHD16B Protein, His (Fc)-Avi-tagged | +Inquiry |
Faslg-373R | Recombinant Rat Faslg protein(Leu104-Leu278), His-tagged | +Inquiry |
CA4-812H | Recombinant Human CA4 Protein | +Inquiry |
Catroxase II-1287C | Recombinant Crotalus atrox Catroxase II protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
CRP-8059R | Native Rat Serum C-Reactive Protein | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
PACSIN1-1273HCL | Recombinant Human PACSIN1 cell lysate | +Inquiry |
ZNF446-2029HCL | Recombinant Human ZNF446 cell lysate | +Inquiry |
TMEM100-1018HCL | Recombinant Human TMEM100 293 Cell Lysate | +Inquiry |
ADI1-9011HCL | Recombinant Human ADI1 293 Cell Lysate | +Inquiry |
FAM207A-8096HCL | Recombinant Human C21orf70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All taz Products
Required fields are marked with *
My Review for All taz Products
Required fields are marked with *
0
Inquiry Basket