Recombinant Full Length Dictyostelium Discoideum Protein Odr-4 Homolog(Ddb_G0283829) Protein, His-Tagged
Cat.No. : | RFL677DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Protein odr-4 homolog(DDB_G0283829) Protein (Q54QH3) (1-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-456) |
Form : | Lyophilized powder |
AA Sequence : | MIINSNIKITLEERSNKLEQSHIEIGLLIGQESEISEQQTFVLGLFPTPLNISNTDDDNN NKPINIDSISSIDKEWILEYCHQVNIMLYGGIDIVGIYMIIPDSDTLNEKNNESFIMKLL KSIHTIINSKSLQFISYSKKTGLINGKATNSTQLYRLKSTEIKVINNLENEFLSLHCILP IDIKLKSKNGMISFENLKKDIIEIFENQLFKESTLLIENEFVSGNEIISQQFKSKSKLNI DLLINQLDSISTSSLEFNFNNNNNTHCIAYIHQLEQIKTAFKFIKKDIIKSVESRFDLLF NEISSNNNNNDNDQDNIKLSKESPILELPRRVNIQWLSNKISICDYLSSNGTIDDCYKII NDLLQITSPKINSIESSKNNNNNNNNNNNNNNNNNNNNSKLSNKKENNEIKENKDTQSNL TKSTSQQQTKQTNNSYLIIIISVLVLMVAFYFKFFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0283829 |
Synonyms | DDB_G0283829; Protein odr-4 homolog |
UniProt ID | Q54QH3 |
◆ Recombinant Proteins | ||
CDKN2A-6004C | Recombinant Chicken CDKN2A | +Inquiry |
ERBB4-2678H | Recombinant Human ERBB4 Protein (Cys29-Asn278), His tagged | +Inquiry |
MMP14-657H | Recombinant Human MMP14 protein, His-tagged | +Inquiry |
ENPEP-12457H | Recombinant Human ENPEP, His-tagged | +Inquiry |
TRA2B-6244C | Recombinant Chicken TRA2B | +Inquiry |
◆ Native Proteins | ||
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
TSH-1315B | Active Native Bovine TSH Protein | +Inquiry |
COL1-118H | Native Human Collagen Type I protein | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2RB-1137RCL | Recombinant Rat CSF2RB cell lysate | +Inquiry |
POLD4-3051HCL | Recombinant Human POLD4 293 Cell Lysate | +Inquiry |
P4HA2-3481HCL | Recombinant Human P4HA2 293 Cell Lysate | +Inquiry |
HA-2605ICL | Recombinant Influenza B HA cell lysate | +Inquiry |
DNAJC22-632HCL | Recombinant Human DNAJC22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0283829 Products
Required fields are marked with *
My Review for All DDB_G0283829 Products
Required fields are marked with *
0
Inquiry Basket