Recombinant Full Length Dictyostelium Discoideum Probable Cytochrome P450 525A1(Cyp525A1) Protein, His-Tagged
Cat.No. : | RFL13309DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Probable cytochrome P450 525A1(cyp525A1) Protein (Q7KWN2) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MDTTKNNDEFDISYFLTCSIFGFILWILTEQILKYYNKTNKNNKYNLPKGPSFLKWFINY LFNFYDLKLSNNKEEDNNNNNNKSNNSLSQEELIEDTSENTVLKWFNQLNSDNYSVSFFG RPMIFTRDTTISKYILSSNNIDNYTKPPDSSGVLIRLAQNSILMSEGDQWRYHRSIINQP FSSKNVKLMIPTIITTINKLINHLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTIIIDIHSYCTKLTFDIIGKLSIGYDFNSIESSDNDNDNNDD DDISKQFDFILNEMIRPIRRFSSYLPLYNDIKLFKFLNELESIIKGAINSRSLITDNNNN KTYKKNFLLDNLLDDNVKEKDIIGNINTFLLAGHETSANLLTFIFYLLSTHNNVQNDLYN HLIENQKKKINKDNKFTEEDEDYQSIEFLDWVIYETLRLFPPAPMIGRTSKNDDILKSGN NNNNNNNNISIPSETLILISVYAIHRDPKLWKDPNIFNPYRWKNIENINNRSDFIPFSSG GRVCVGQKFSIVEARIIISKLILNFELSFNNLKSKPFKIYQRATLTPKYPVFLNFKKREN K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cyp525A1 |
Synonyms | cyp525A1; DDB_G0272652; Probable cytochrome P450 525A1 |
UniProt ID | Q7KWN2 |
◆ Recombinant Proteins | ||
CLC-4142H | Recombinant Human CLC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TXNDC17-3499H | Recombinant Human TXNDC17, GST-tagged | +Inquiry |
UBE2V1-3548H | Recombinant Human UBE2V1, GST-tagged | +Inquiry |
RFL5633HF | Recombinant Full Length Human Putative Protein Ctage-6(Ctage6P) Protein, His-Tagged | +Inquiry |
SLC35A4-2166H | Recombinant Human SLC35A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
Lectin-1748B | Active Native Bauhinia Purpurea Lectin Protein | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC42-4629HCL | Recombinant Human LRRC42 293 Cell Lysate | +Inquiry |
Lung-110M | Mouse Lung Tissue Lysate (14 Days Old) | +Inquiry |
ASL-001HCL | Recombinant Human ASL cell lysate | +Inquiry |
RAD54L-2552HCL | Recombinant Human RAD54L 293 Cell Lysate | +Inquiry |
CASP8-7829HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cyp525A1 Products
Required fields are marked with *
My Review for All cyp525A1 Products
Required fields are marked with *
0
Inquiry Basket