Recombinant Full Length Dictyostelium Discoideum Metabotropic Glutamate Receptor-Like Protein C(Grlc) Protein, His-Tagged
Cat.No. : | RFL3351DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Metabotropic glutamate receptor-like protein C(grlC) Protein (Q54SH7) (22-800aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-800) |
Form : | Lyophilized powder |
AA Sequence : | DKEFKMLTLLTAQVDDLGFNNMINQGRIEVAKGMNIEDSRLLVVEGFNETFKHLLPIVQN DDIDLVICSSSGHLQACRAIAEMYINSTTIKTQFLVRGSSSPTRNLIYISYNYASANYIS GYFAALFSKTGKIGFVSPGQAANNNDSFVYAFWVGARQVNPDIKFYYYNIGNYLDVDKTV AATNDLLDMGCDVVGNTLDDFSTGDASIARGFPAIGTNGFPQRHVYGENVIYSYSYNWTK FFLPIAESVKSGNTNNSQWYADFDFDENKNFYHLDYGFEVNQSILDKMNTEIDYLKSTDR MSHPYYCNELIPQYAKENNLKLANVTGITLPIGCVTHQTFLSINKPFPGMTYLGNYKIKL VEVEFSQSLQYGFSITTGVLIAITIIMMLGIVRYKSTPSIRSASPIFLNFILAGGIIVYI GIIVWVGPANDHQCNARLWLVTLGFSTLIGSLVVKNFRIWLIFDNPELKSISITNYQLFP WVGACLVINIILMSILTSVGDLREIDAQGIDSLGKYEFMKVCKMNSSGASTLYTILAYFA ALLLVGVFVSWKIRIVDIQEFNESKAIANTLYAISFCLFVIVPLMISPQDKQSETIVLCT AGLFITTAALLIIFTPKFWRVFTLGDGGTNDMFRKKQSNVATARAESSKSSSGPKLNRRG NLVSDDFTDTETSISEKKVNVVAGAVLAEFTDDTISEFDDNNIEQDNDNDNDNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNTSQPNDEKVEEKQQNDTEEEDKNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | grlC |
Synonyms | grlC; DDB_G0282461; Metabotropic glutamate receptor-like protein C |
UniProt ID | Q54SH7 |
◆ Recombinant Proteins | ||
MMP2-1122C | Recombinant Chicken MMP2 Protein, His-tagged | +Inquiry |
Adamts6-368M | Recombinant Mouse Adamts6 Protein, MYC/DDK-tagged | +Inquiry |
RFL7073GF | Recombinant Full Length Geobacillus Thermodenitrificans Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
Hnrnpk-1151M | Recombinant Mouse Hnrnpk Protein, MYC/DDK-tagged | +Inquiry |
PRSS21-2245H | Recombinant Human PRSS21 Protein (42-288 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
Interferon alfa-P029H | Native Human interferon alpha therapeutic protein (Interferon alfa-n3) | +Inquiry |
Lectin-1741M | Active Native Musa Paradisiaca (Banana) Lectin Protein | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCE1B-4808HCL | Recombinant Human LCE1B 293 Cell Lysate | +Inquiry |
ZNF320-96HCL | Recombinant Human ZNF320 293 Cell Lysate | +Inquiry |
LYZ-4580HCL | Recombinant Human LYZ 293 Cell Lysate | +Inquiry |
ANXA3-8832HCL | Recombinant Human ANXA3 293 Cell Lysate | +Inquiry |
LSM11-4611HCL | Recombinant Human LSM11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All grlC Products
Required fields are marked with *
My Review for All grlC Products
Required fields are marked with *
0
Inquiry Basket