Recombinant Human PRSS21 Protein (42-288 aa), His-tagged

• Cat.No.: PRSS21-2245H
• Product Overview: Recombinant Human PRSS21 Protein (42-288 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 42-288 aa
• Description: Could regulate proteolytic events associated with testicular germ cell maturation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.8 kDa
• AA Sequence: IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PRSS21 protease, serine, 21 (testisin) [ Homo sapiens ]
• Official Symbol: PRSS21
• Synonyms: PRSS21; testisin; ESP 1; TEST1; TESTISIN; serine protease 21; ESP1; ESP-1
• Gene ID: 10942
• mRNA Refseq: NM_006799
• Protein Refseq: NP_006790
• MIM: 608159
• UniProt ID: Q9Y6M0