Recombinant Full Length Dictyostelium Discoideum Cyclic Amp Receptor 3(Carc) Protein, His-Tagged
Cat.No. : | RFL8870DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Cyclic AMP receptor 3(carC) Protein (P35352) (1-490aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-490) |
Form : | Lyophilized powder |
AA Sequence : | MENLNTTSTAALTGMTKQENDASYAVLLIADFTSIIGCTLVLLGFWRLKLLRNHITKIIT FFCSTSLAKDLISTILTLIEKKQSNGSFQCYLYATVITYGSLACWLWTLCLSFSIYNLIV KREPEPEKFEKYYHVFCWVVPFIMSVIMLSKGVIEVTGNWCWIGNTYVGYRFGLFYGPFL AIWFLAAVLVGLTSRYTYKVIRSSVSDNKDRHMTYQFKLINYIIVFLLCWVFAVINRIVN GLNMFPAWVSILHTYLSVSHGFYASVTFIYNNPLMWRYLASIILIPFTKFGYFVETQQRL EKNKNNNNHSPVGLSNNAQNNNHHHNHNNNHNNNHNNHNNNNNNNNSDFVNNDSSNYYTA SMIESFSVQNENSKSINGADNFKQNGASQQDDKDSPNSNNNNNNNNNNNNNNNNNNNNNN NNNNYNNKDIEPIDNCNTNSIPMDNIATRIEIPPQHPTLTPQQSLQEINLNDDDNKINTH QSNKKKDSNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | carC |
Synonyms | carC; car3; DDB_G0277829; Cyclic AMP receptor 3; cAMP receptor 3 |
UniProt ID | P35352 |
◆ Recombinant Proteins | ||
IKBKE-125H | Active Recombinant Human IKBKE, GST-tagged | +Inquiry |
PNPLA7-3860C | Recombinant Chicken PNPLA7 | +Inquiry |
RFL5575SF | Recombinant Full Length Saccharomyces Cerevisiae Membrane Protein Ptm1(Ptm1) Protein, His-Tagged | +Inquiry |
RPSN-5238S | Recombinant Staphylococcus lugdunensis HKU09-01 RPSN protein, His-tagged | +Inquiry |
Postn-3297M | Recombinant Full Length Mouse Postn, Isoform 2, His tagged | +Inquiry |
◆ Native Proteins | ||
VCL tail-900T | Native Turkey VCL tail Protein | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD24-1407RCL | Recombinant Rat CD24 cell lysate | +Inquiry |
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
RAB6A-2587HCL | Recombinant Human RAB6A 293 Cell Lysate | +Inquiry |
SLC25A13-1622HCL | Recombinant Human SLC25A13 cell lysate | +Inquiry |
SELL-1131CCL | Recombinant Cynomolgus SELL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All carC Products
Required fields are marked with *
My Review for All carC Products
Required fields are marked with *
0
Inquiry Basket