Recombinant Full Length Dictyostelium Discoideum Abc Transporter G Family Member 23(Abcg23) Protein, His-Tagged
Cat.No. : | RFL31559DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum ABC transporter G family member 23(abcG23) Protein (Q55EH8) (1-701aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-701) |
Form : | Lyophilized powder |
AA Sequence : | MGDNIVINLNNVSRSYGNVKVIEKLNFTINKGTINSLIGSSGSGKTTILKTILGKLKQDD GIVQVFGKEPCGKGSEIPGSSVGYAPQDVCLYNEITIEETLSFFASIHRMPKDEYIKKRD SLVEILELPSLSKIISELSGGQQRRVSLATALIHSPKLLILDEPTVGVCPLVSSKIWEHL IFLTKNFGVTIIITTHYLQECRSCDNIFLLRNGRILESGPPNYLLSKYECSLLEDVYYKL CRGDEEISLQLIDSKNNEKINRDINTSIPLEFISNGANINNDDILISNTNKPIIKKDAKI YKERLSDFKNKLQIWFSHSITISIRKLTQMYRLKFPLVFEIISPSLLITLFFLAIGNVPH DLKFGIKNIDSGSLSGDFINALSDGNNIFNFIQINDTSNAIQMIESSDLWGLIDIPVNFT NGMINKLFNPLEKSFENSEMEIYMDLSNFQMNLMVDVQFQKAFNKIANDSGIKLLPTNFH AVYGDQNANFNWFLAPAMICIITYVHCMNFLSITFVREKNDGTRDRILLYGVSPVSNVLG HILAHIPILLVQFSIQLLIAVFAFGVPIKGNIVLIYLFFILINTVGMCQGILISLISKAE VDAVQLCLAIFICSLCMAGIIWPTEAIITFGWISNLVPTKWSGLALRGIMIKDLPFSHQH IWKSLIIIISYIIGTFSLIVISTPIGDRNFNFKKLFKRIKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | abcG23 |
Synonyms | abcG23; DDB_G0269026; ABC transporter G family member 23; ABC transporter ABCG.23 |
UniProt ID | Q55EH8 |
◆ Recombinant Proteins | ||
CLINT1-3257H | Recombinant Human CLINT1 Protein, His-tagged | +Inquiry |
Cd200r1-631M | Recombinant Mouse Cd200r1 protein(Met1-Pro238), His&hFc-tagged | +Inquiry |
ZNF641-2488H | Recombinant Human ZNF641 protein, His-tagged | +Inquiry |
ASCL1-901H | Recombinant Human ASCL1 protein, GST-tagged | +Inquiry |
STX8-2401C | Recombinant Chicken STX8 | +Inquiry |
◆ Native Proteins | ||
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
ACTB-882P | Native Porcine ACTB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIFM3-8952HCL | Recombinant Human AIFM3 293 Cell Lysate | +Inquiry |
DPP10-2070HCL | Recombinant Human DPP10 cell lysate | +Inquiry |
CCDC54-7760HCL | Recombinant Human CCDC54 293 Cell Lysate | +Inquiry |
QKI-2638HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
PRKAG1-2866HCL | Recombinant Human PRKAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All abcG23 Products
Required fields are marked with *
My Review for All abcG23 Products
Required fields are marked with *
0
Inquiry Basket