Recombinant Full Length Dictyoglomus Turgidum Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL7969DF |
Product Overview : | Recombinant Full Length Dictyoglomus turgidum Protein translocase subunit SecD(secD) Protein (B8E2N3) (1-399aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyoglomus turgidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-399) |
Form : | Lyophilized powder |
AA Sequence : | MNIRPEIKTAFIVIILGIAIWILLTFPFRYGLDIRGGIRVTLQCQKTEGVEITDDAVRRT IEVIRNRIDQLGVTEPSIYKEGSDKIVVELPGIKDPERALEIIGQTALLEFKDETGKTIL TGSALKNAKVEFDQVGQPMVRVEMNPEGAKIFADFTSKNVGKQVFIVLDGKVISNPVIKE PITEGTGVITGRFTIDEAQKLAILLRAGALPVPVKVIENRTIDPTLGKDTMESAYRAGVI GAILVVLFMILVFRFLGLVADIALLIYVVLDLAALKLLNATLTLPGVAGIILSIGMAVDA NCLIFARMKEEYAQRKTPMASLDAGFRNALRAIIDSNVTTILAALILFYFGTGPIRGFAV TLSLGVALSMFTQITITRTLLENLLSLPVFKKATKLLGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Dtur_1604; Protein translocase subunit SecD |
UniProt ID | B8E2N3 |
◆ Recombinant Proteins | ||
ATP2A3-2783H | Recombinant Human ATP2A3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL27828CF | Recombinant Full Length Probable G-Protein Coupled Receptor F27E5.8(F27E5.8) Protein, His-Tagged | +Inquiry |
ANXA1-344R | Recombinant Rat ANXA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BEND7-2375M | Recombinant Mouse BEND7 Protein | +Inquiry |
NPHP3-6028H | Recombinant Human NPHP3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
Arp 2/3 complex-856P | Native Porcine Arp 2/3 complex Protein | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MASP1-4461HCL | Recombinant Human MASP1 293 Cell Lysate | +Inquiry |
NP-003HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
HL60-164H | HL60 Whole Cell Lysate | +Inquiry |
MATK-4451HCL | Recombinant Human MATK 293 Cell Lysate | +Inquiry |
HeLa-11H | HeLa Cell Nuclear Extract | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket