Recombinant Full Length Pyrococcus Furiosus Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL12000PF |
Product Overview : | Recombinant Full Length Pyrococcus furiosus Protein translocase subunit SecD(secD) Protein (Q8U4B4) (1-505aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyrococcus furiosus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-505) |
Form : | Lyophilized powder |
AA Sequence : | MKWRRILLNFRVIVLIFFLLISITALATRGLTFGLDISGGISITVKLEKPVDSQTMEQVK IALEQRLNTLGVKNIVVEPWGDQFVIVKVANVTEEEADQLIKTIERQGVFYAEFQGIIFA TGKDILNVGSVSYDPQHSAWVVPFRLSKEAAEKFAQLALGKAGYPVDMFLDPPVNSTLVV SNRVYEAMLSKTFMLEGDMTLVERIEKAFGIKVVPYANVTPEEIAEIAKGSERIILLDVD GNLSKALKEMGFEVETRSMRSDEDVYDFIKRSLGLYGPYRVSEGLATGNPSTEVMISITA PKTDIQARQDAQVVSVVLRSGSLPVKLSIERIDYISPKLGENFKRQVLVAGIAALLVVGL IVFLHYRKIKIAIPVMFTSFSEVLIILGIAALIRWNLDLPSIAGIIAAIGTGVDQQIVIT DELLGEEESRRRVKRSGVLRRMGRAFFIILASATTTIVAMSFLFKFFVGGLRGFAFTTIL GVLVGIFITRPAYGEIAKVLIGERR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; PF0174; Protein-export membrane protein SecD |
UniProt ID | Q8U4B4 |
◆ Recombinant Proteins | ||
IL1RL2-337H | Recombinant Human IL1RL2 protein, Fc-tagged | +Inquiry |
CAPN12-2817HF | Recombinant Full Length Human CAPN12 Protein, GST-tagged | +Inquiry |
GALK2-2271C | Recombinant Chicken GALK2 | +Inquiry |
Opa3-8012R | Recombinant Rat Opa3 protein, His & T7-tagged | +Inquiry |
RFL19257SF | Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Ypr063C(Ypr063C) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
VCL tail-900T | Native Turkey VCL tail Protein | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
Collagen-56B | Native Bovine Collagen Type II | +Inquiry |
LH-9389B | Active Native Bovine LH Protein | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
LRAT-4660HCL | Recombinant Human LRAT 293 Cell Lysate | +Inquiry |
DTL-6801HCL | Recombinant Human DTL 293 Cell Lysate | +Inquiry |
H3F3A-5654HCL | Recombinant Human H3F3A 293 Cell Lysate | +Inquiry |
MPP7-4228HCL | Recombinant Human MPP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket