Recombinant Full Length Desulfitobacterium Hafniense Upf0365 Protein Dsy1747(Dsy1747) Protein, His-Tagged
Cat.No. : | RFL4673DF |
Product Overview : | Recombinant Full Length Desulfitobacterium hafniense UPF0365 protein DSY1747(DSY1747) Protein (Q24WQ6) (1-333aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Desulfitobacterium hafniense |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-333) |
Form : | Lyophilized powder |
AA Sequence : | MNMPIEVLMPIILLALALILISVVFTFIPVGLWISALAAGVNVGIFTLVGMRLRRVTPSR IVNPLIKAHKAGLRVTTAQLEAHYLAGGNVDRVVNALIAAERAAIPLQFERAAAIDLAGR DVLEAVQMSVNPKVIETPVVSAVAKNGIELRVKARVTVRANIDRLVGGAGEETIIARVGE GIVTSIGSSLSHEKVLENPDMVSRTVLAKGLDSGTAFEILSIDIADVDVGKNIGAQLQTD QAEADKRIAQAKAEERRAMAVAKEQEMIAYVQEMRAKVVEAESEVPRALAEALKEGKLGV MDYYTMQNIMADTSMRDNIARSSNSNTDSNPKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DSY1747 |
Synonyms | floA; DSY1747; Flotillin-like protein FloA |
UniProt ID | Q24WQ6 |
◆ Recombinant Proteins | ||
PMAIP1-1804H | Recombinant Human PMAIP1 protein, His-tagged | +Inquiry |
CCL8-34H | Recombinant Human CCL8 Protein | +Inquiry |
RFL21891HF | Recombinant Full Length Uncharacterized Protein Rv2273/Mt2334 (Rv2273, Mt2334) Protein, His-Tagged | +Inquiry |
GCFC2-6105Z | Recombinant Zebrafish GCFC2 | +Inquiry |
RFL30855SF | Recombinant Full Length Staphylococcus Epidermidis Monofunctional Glycosyltransferase(Mgt) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
SNCB-27206TH | Native Human SNCB | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRB10-751HCL | Recombinant Human GRB10 cell lysate | +Inquiry |
KRTAP10-2-960HCL | Recombinant Human KRTAP10-2 cell lysate | +Inquiry |
CRB3-394HCL | Recombinant Human CRB3 cell lysate | +Inquiry |
CSNK1D-7241HCL | Recombinant Human CSNK1D 293 Cell Lysate | +Inquiry |
GNL1-5848HCL | Recombinant Human GNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSY1747 Products
Required fields are marked with *
My Review for All DSY1747 Products
Required fields are marked with *
0
Inquiry Basket