Recombinant Human CCL8 Protein
Cat.No. : | CCL8-34H |
Product Overview : | Recombinant Human CCL8 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Monocyte chemotactic protein 2 (MCP-2), also known as CCL8, is a cytokine that is important during allergic and inflammatory responses. MCP-2 activates mast cells, eosinophils, and basophils through the G protein-coupled chemokine receptors CCR1, CCR2B, and CCR5. MCP-2 signaling through the CCR5 receptor also functions as a natural inhibitor of the human immunodeficiency virus, type 1 (HIV-1). |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 8.9 kDa (76 aa) |
AA Sequence : | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL8 chemokine (C-C motif) ligand 8 [ Homo sapiens (human) ] |
Official Symbol | CCL8 |
Synonyms | CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10; |
Gene ID | 6355 |
mRNA Refseq | NM_005623 |
Protein Refseq | NP_005614 |
MIM | 602283 |
UniProt ID | P80075 |
◆ Recombinant Proteins | ||
CCL8-30121H | Recombinant Human CCL8 protein, GST-tagged | +Inquiry |
CCL8-2656H | Recombinant Human CCL8 protein, GST-tagged | +Inquiry |
Ccl8-100M | Recombinant Mouse Ccl8 protein | +Inquiry |
CCL8-079C | Active Recombinant Human CCL8 Protein (76 aa) | +Inquiry |
Ccl8-003M | Active Recombinant Mouse Ccl8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL8 Products
Required fields are marked with *
My Review for All CCL8 Products
Required fields are marked with *
0
Inquiry Basket