Recombinant Full Length Danio Rerio Transmembrane Protein 237A(Tmem237A) Protein, His-Tagged
Cat.No. : | RFL9325DF |
Product Overview : | Recombinant Full Length Danio rerio Transmembrane protein 237A(tmem237a) Protein (F1Q930) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MCVTSRADKMPSVKPKKKKIKKEINEVEEPEAGPEPAIEMEGLESRRQSESREPLTPEPH DNPPLKKKKKKKTHTFENEGEQQDHPNGDVQESPTDGEEVTKKSKKKRKNKMMENQSHNE LGVEEDDIITDVHAPISQRSLFSAPLSHSHPIGKVFVEKNRRFQATDLSHDHLEEYMEVR PMWNTRDVAMRVHSGFRIIGLFSHGFLAGYAVWNIIVVYVLAGEQMTTLPNLLQQYHSLA YPAQSLLYLLLAISTVSAFDRVNLAKASMALRGFLTLDPAALASFLYFAALILSLSQQMT SDRIHLYPTANETLWPPGLEHQILQPWIVVNLVVALLVGLAWVFVATRPDMDYTEEFLMA MEVEEYPRHDDKHELAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem237a |
Synonyms | tmem237a; als2cr4a; Transmembrane protein 237A; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog A |
UniProt ID | F1Q930 |
◆ Recombinant Proteins | ||
MSH2-3787R | Recombinant Rat MSH2 Protein | +Inquiry |
RPMH-3026S | Recombinant Staphylococcus epidermidis ATCC 12228 RPMH protein, His-tagged | +Inquiry |
HOXB13-2425H | Recombinant human HOXB13, His-tagged | +Inquiry |
ADNPA-4965Z | Recombinant Zebrafish ADNPA | +Inquiry |
PAPPA-1607H | Recombinant Human PAPPA Protein, His&Avi tagged | +Inquiry |
◆ Native Proteins | ||
HPX-29307TH | Native Human HPX | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
Protein Z-91H | Native Human Protein Z | +Inquiry |
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDHD1A-5596HCL | Recombinant Human HDHD1A 293 Cell Lysate | +Inquiry |
Breast-57H | Human Breast Membrane Lysate | +Inquiry |
EED-531HCL | Recombinant Human EED cell lysate | +Inquiry |
SESTD1-1929HCL | Recombinant Human SESTD1 293 Cell Lysate | +Inquiry |
SERPINA7-2552HCL | Recombinant Human SERPINA7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tmem237a Products
Required fields are marked with *
My Review for All tmem237a Products
Required fields are marked with *
0
Inquiry Basket