Recombinant Full Length Danio Rerio Transmembrane Protein 236(Tmem236) Protein, His-Tagged
Cat.No. : | RFL17623DF |
Product Overview : | Recombinant Full Length Danio rerio Transmembrane protein 236(tmem236) Protein (A5WVU6) (1-350aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-350) |
Form : | Lyophilized powder |
AA Sequence : | MLSGKTVKLIVFELLQFACLCIPVFVVMERFASVIRFVKSSDTAYWLVVAASVAYAASVT LFVWVPLKYFMLKTQRFSEVTNWRPVTLAYVILSTLPCFAIIIASSKVQADAAIRFDRLT ELPVSLVLFSLICVDIVERIRPLRLTGKASGLDLDLEMPGPVLTHLEQVTSISGHLQANG QDGDASFRSPVSNGSLSGRWEDARTYGLPRTSSSAYLYSHSHSGPFSFLWKRDPRHDLFV SSFMFWLDTVEMVRVAGTNSVFYSGWVFPIYILAYLSLLRVVITPDSPLLALSSILSQDL PFLVVRICLLAVFGYVTPVLYILKNILASISFVYFVFMTKLKLLNRGSMF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem236 |
Synonyms | tmem236; si:dkey-32m20.1; Transmembrane protein 236 |
UniProt ID | A5WVU6 |
◆ Recombinant Proteins | ||
FABP5-4245H | Recombinant Human FABP5 protein, His-tagged | +Inquiry |
GCGR-518M | Recombinant Mouse GCGR Protein (27-143 aa), GST-tagged | +Inquiry |
Evi2a-983M | Recombinant Mouse Evi2a Protein, MYC/DDK-tagged | +Inquiry |
LIMK2-9109M | Recombinant Mouse LIMK2 Protein | +Inquiry |
TUBB5-6365R | Recombinant Rat TUBB5 Protein | +Inquiry |
◆ Native Proteins | ||
CGB-29186TH | Native Human CGB | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP45-453HCL | Recombinant Human USP45 293 Cell Lysate | +Inquiry |
PRELID2-2874HCL | Recombinant Human PRELID2 293 Cell Lysate | +Inquiry |
SUPT3H-1339HCL | Recombinant Human SUPT3H 293 Cell Lysate | +Inquiry |
WDR25-735HCL | Recombinant Human WDR25 lysate | +Inquiry |
CA14-3064MCL | Recombinant Mouse CA14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem236 Products
Required fields are marked with *
My Review for All tmem236 Products
Required fields are marked with *
0
Inquiry Basket