Recombinant Full Length Human Transmembrane Protein 236(Tmem236) Protein, His-Tagged
Cat.No. : | RFL1977HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 236(TMEM236) Protein (Q5W0B7) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MASGRLIKFVVFELLEFAAFSIPTLVITEQFATAYQGTRARSDNTHYWLIISCSIAYVAL VTLLIWVPVKVILHKKRYIYRKIKGWRPVLMMCVVLTTLPCLTFSIAVTEVQKSINGSAD VLPDMLPDLPVSLVLLSLIMVDIIEKLRIYPLRGSQKSSENGHIHSTSLQHIKTVTEQVR QSPENAASPQATNSTQVSQPSGAMTRSQESVFMGPQEPSCDSGILRMMSRRDVRAELFLW SFLLWSDTIEMVRVAGHPNVYKSSWLYPVYIFSFISLLRITFTPQNPLLNSLSVLLQDLP FVFVRLGLIIALGTITPVLGLCKNILVTLSYIYFNYLTRIRIFSAFEMSPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM236 |
Synonyms | TMEM236; FAM23A; FAM23B; Transmembrane protein 236 |
UniProt ID | Q5W0B7 |
◆ Recombinant Proteins | ||
CTRB1-2094H | Recombinant Human CTRB1 Protein, GST-tagged | +Inquiry |
DSTYK-12184H | Recombinant Human DSTYK, GST-tagged | +Inquiry |
CD46-2331G | Recombinant Guinea Pig CD46 Protein (36-316 aa), His-tagged | +Inquiry |
SLC19A1-1651C | Recombinant Chicken SLC19A1 | +Inquiry |
DAPK3-1002R | Recombinant Rhesus Macaque DAPK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
L. pneumophila-26 | Native Legionella pneumophila Antigen | +Inquiry |
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
Plg-291M | Active Native Mouse glu-Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
UQCR10-490HCL | Recombinant Human UQCR10 293 Cell Lysate | +Inquiry |
CCKAR-7736HCL | Recombinant Human CCKAR 293 Cell Lysate | +Inquiry |
WRAP53-283HCL | Recombinant Human WRAP53 293 Cell Lysate | +Inquiry |
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
SH3BGRL-1874HCL | Recombinant Human SH3BGRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM236 Products
Required fields are marked with *
My Review for All TMEM236 Products
Required fields are marked with *
0
Inquiry Basket