Recombinant Full Length Danio Rerio Glucose-6-Phosphatase 3(G6Pc3) Protein, His-Tagged
Cat.No. : | RFL31167DF |
Product Overview : | Recombinant Full Length Danio rerio Glucose-6-phosphatase 3(g6pc3) Protein (A1A5Z0) (1-339aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-339) |
Form : | Lyophilized powder |
AA Sequence : | MESLYRQGVWMAEALQQNSRSLEDLWLVASHMGDPKAAVLLVFPVVFYIHRRTGIAVLWV AALSEWLNLVFKWILFGERPYWWIGQSGLFSEKPPEVQQFQSTCESGPGSPSGHAMVTSA VWWVIISSLASFSQAYTGSKILSAVLYLLYAVFLGCVGLSRIFILAHFPHQVVAGLLTGV LLGVFLKRSVPERRPLLFFFRFSMALLGAALIFHAVLEKTGIDLSWSISLAKRWCSRSEW VRMDTAPFSSLNRDAGVLLGLGLAQYWKPGGWTLPRAPRTLCLALSSLALHYISRFPLPT VPPLLFYSLFFLKYSIVPQVVMVLVPGFVHLLTAKPKRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | g6pc3 |
Synonyms | g6pc3; zgc:158425; Glucose-6-phosphatase 3; G-6-Pase 3; G6Pase 3 |
UniProt ID | A1A5Z0 |
◆ Native Proteins | ||
ECV-309S | Native Snake ECV- PROTHROMBIN ACTIVATOR | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLT8D2-5894HCL | Recombinant Human GLT8D2 293 Cell Lysate | +Inquiry |
KDR-1520MCL | Recombinant Mouse KDR cell lysate | +Inquiry |
ILF2-5222HCL | Recombinant Human ILF2 293 Cell Lysate | +Inquiry |
STX8-1030HCL | Recombinant Human STX8 cell lysate | +Inquiry |
CREB3L3-7287HCL | Recombinant Human CREB3L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All g6pc3 Products
Required fields are marked with *
My Review for All g6pc3 Products
Required fields are marked with *
0
Inquiry Basket