Recombinant Full Length Danio Rerio G-Protein Coupled Receptor 183-A(Gpr183A) Protein, His-Tagged
Cat.No. : | RFL26475DF |
Product Overview : | Recombinant Full Length Danio rerio G-protein coupled receptor 183-A(gpr183a) Protein (A5PLE7) (1-368aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-368) |
Form : | Lyophilized powder |
AA Sequence : | METTSANFTQNDSNVCTNLYNHRGWAQYFLPAMYSLICIVGLLGNVLALHVIWPNLKKIN STTLYSANLVVSDILFSLALPLRVVYYARGFDWPMGEGLCKAVALLFYINMYAGVNFMTC LSVDRFIAVVLPLRFSRFRKVQKVRYICGVVWVVVLMQTLPLLSMPMTNIEQSGHITCME YPNFEKIDNLPVMLIGAVVLGFGIPVITILVCYTALCLKLRHLAKSNKLTEKSGRSSKAI GVICTVILVFVVCYSPYHVDLLQYMIKKLRYDPDCSELHKFQISLHITVCFMNLNSCLDP FIYFFACKGYKKKVLKLLKKQVSMSFSSVVRTSPEGSSKDVFGNDKIQMNSRSFQKERSS VLLNSLEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpr183a |
Synonyms | gpr183a; gpr183; zgc:165579; G-protein coupled receptor 183-A |
UniProt ID | A5PLE7 |
◆ Recombinant Proteins | ||
ITGB4-6964H | Recombinant Human ITGB4 protein, His & T7-tagged | +Inquiry |
LGALS9-445H | Recombinant Human LGALS9 protein, His-tagged | +Inquiry |
NI36-RS02375-1096S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS02375 protein, His-tagged | +Inquiry |
AGPAT5-523H | Recombinant Human AGPAT5 Protein, MYC/DDK-tagged | +Inquiry |
DYX1C1-12242H | Recombinant Human DYX1C1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMOC2-1657HCL | Recombinant Human SMOC2 293 Cell Lysate | +Inquiry |
SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
HCP5-5610HCL | Recombinant Human HCP5 293 Cell Lysate | +Inquiry |
THEM4-1775HCL | Recombinant Human THEM4 cell lysate | +Inquiry |
AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gpr183a Products
Required fields are marked with *
My Review for All gpr183a Products
Required fields are marked with *
0
Inquiry Basket