Recombinant Full Length Danio Rerio Apelin Receptor B(Aplnrb) Protein, His-Tagged

• Cat.No.: RFL33896DF
• Product Overview: Recombinant Full Length Danio rerio Apelin receptor B(aplnrb) Protein (A0T2N3) (1-359aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Danio rerio (Zebrafish) (Brachydanio rerio)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-359)
• AA Sequence: MNAMDNMTADYSPDYFDDAVNSSMCEYDEWEPSYSLIPVLYMLIFILGLTGNGVVIFTVW RAQSKRRAADVYIGNLALADLTFVVTLPLWAVYTALGYHWPFGVALCKISSYVVLLNMYA SVFCLTCLSLDRYMAIVHSLTSTQLRTRGHMRASLTAIWLLSGVLAAPTLLFRTTVYDVE TNRTSCAMDFNLVVSQPGQETYWIAGLSISSTALGFLIPLLAMMVCYGFIGCTVTRHFNS LRKEDQRKRRLLKIITTLVVVFAACWMPFHVVKTMDALSYLNLAPDSCTFLNLLLLAHPY ATCLAYVNSCLNPLLYAFFDLRFRSQCLCLLNLKKALHASPASSLSSQKTEAQSLATKV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: aplnrb
• Synonyms: aplnrb; agtrl1b; grn; zgc:114063; Apelin receptor B; Angiotensin II receptor-like 1b; Angiotensin receptor-like 1b; G-protein coupled receptor APJ B; Protein grinch
• UniProt ID: A0T2N3