Recombinant Full Length Cytochrome C Oxidase Subunit 2 Protein, His-Tagged
Cat.No. : | RFL30709PF |
Product Overview : | Recombinant Full Length Cytochrome c oxidase subunit 2 Protein (P29163) (1-243aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pneumocystis carinii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-243) |
Form : | Lyophilized powder |
AA Sequence : | MNNIIHNDAPTPWGIYFQDGASPVYDGIVELHDQVLFYLLIVLVGVSWILFSTILRFRGS GIVHKYHNHSTTIEFVWTVSPALLLIAIAFPSFKLLYLMDEVIDPSITIKAIGHQWYWSY EYSDYTDKEGQSIEFDSYMLPTEDLEEGQLRQLEVDNRVLVPVNTPLRFIITATDVLHDF AVPSLGIKVDASPGRLNQVSTYVQREGVYYGQCSELCGVLHSSMPIVIEAVSLEKFLSWL DNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cytochrome c oxidase subunit 2 |
Synonyms | Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | P29163 |
◆ Native Proteins | ||
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
IgG-01C | Native Human COVID-19 Convalescent Plasma IgG | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
YIgG-138C | Native Chicken Yolk Immunoglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPST-4223HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
PPIP5K1-793HCL | Recombinant Human PPIP5K1 cell lysate | +Inquiry |
HHLA3-5567HCL | Recombinant Human HHLA3 293 Cell Lysate | +Inquiry |
TEC-1153HCL | Recombinant Human TEC 293 Cell Lysate | +Inquiry |
USP48-1896HCL | Recombinant Human USP48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cytochrome c oxidase subunit 2 Products
Required fields are marked with *
My Review for All Cytochrome c oxidase subunit 2 Products
Required fields are marked with *
0
Inquiry Basket