Recombinant Full Length Cytochrome C Biogenesis Protein Ccs1(Ccs1) Protein, His-Tagged
Cat.No. : | RFL13450CF |
Product Overview : | Recombinant Full Length Cytochrome c biogenesis protein ccs1(ccs1) Protein (O19913) (1-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanidium caldarium (Red alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-396) |
Form : | Lyophilized powder |
AA Sequence : | MVSITLKTNRIFRSCLNLATNLKFSITLFIIICIVSAIGTIIPQDKPKEFYMNTYSLKVL GMPLWKIIQLLSLEKIFYSNFYLILLLCLSFSLFFCSLKSQFPYLRTSRIIKLNNNNPPT SPLHESKKIKYNNIASKNDSSCVQLVSQGYKIYTFDKNLDKAGPLLIHLSLILILLGSAI HAFNDFIAQEMIPIYEVSHIQNVISSGRISKIPQTISLKASAFTVEHENEKVVKQFITNL AMLNSKGEVLKQGLVSVNHPLVYKQVYIFQMDWKLFGIRVNYGKNKIYEFPVQKIEANNE QQWSCTIPAKNQSKLILIFKNMSDEFYVYDNNQNFLKIGKINTPQLIRNTYFTVISKISG TGLQIKKDSSINIVYTGFLLLIIGLVINHKGSKKRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccs1 |
Synonyms | ccs1; ycf14; ycf44; Cytochrome c biogenesis protein Ccs1 |
UniProt ID | O19913 |
◆ Recombinant Proteins | ||
STK36-16147M | Recombinant Mouse STK36 Protein | +Inquiry |
RFL13085EF | Recombinant Full Length Escherichia Coli Abc Transporter Atp-Binding Protein Yoji(Yoji) Protein, His-Tagged | +Inquiry |
Clec4n-5644M | Active Recombinant Mouse Clec4n protein, His-tagged | +Inquiry |
FGR-1406H | Active Recombinant Human FGR, GST-tagged | +Inquiry |
TRIB2-2217H | Recombinant Human TRIB2 protein, His&GST-tagged | +Inquiry |
◆ Native Proteins | ||
APOH-4217H | Native Human APOH protein | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFL2-342HCL | Recombinant Human IGFL2 lysate | +Inquiry |
FABP3-6477HCL | Recombinant Human FABP3 293 Cell Lysate | +Inquiry |
RHBDD1-2365HCL | Recombinant Human RHBDD1 293 Cell Lysate | +Inquiry |
PTPMT1-1436HCL | Recombinant Human PTPMT1 cell lysate | +Inquiry |
SNRPD1-617HCL | Recombinant Human SNRPD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccs1 Products
Required fields are marked with *
My Review for All ccs1 Products
Required fields are marked with *
0
Inquiry Basket