Recombinant Full Length Escherichia Coli Abc Transporter Atp-Binding Protein Yoji(Yoji) Protein, His-Tagged
Cat.No. : | RFL13085EF |
Product Overview : | Recombinant Full Length Escherichia coli ABC transporter ATP-binding protein YojI(yojI) Protein (P33941) (1-547aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-547) |
Form : | Lyophilized powder |
AA Sequence : | MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR DAVARTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yojI |
Synonyms | yojI; yojJ; b2211; JW2199; ABC transporter ATP-binding/permease protein YojI |
UniProt ID | P33941 |
◆ Recombinant Proteins | ||
CCL19-298H | Active Recombinant Human Chemokine (C-C Motif) Ligand 19 | +Inquiry |
RFL18639SF | Recombinant Full Length Shewanella Baltica Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
BCKDHA-27442TH | Recombinant Human BCKDHA, His-tagged | +Inquiry |
Capn2-759M | Recombinant Mouse Capn2 Protein, MYC/DDK-tagged | +Inquiry |
YVDR-3831B | Recombinant Bacillus subtilis YVDR protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
Apotransferrin-36M | Native Mouse Apotransferrin | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNMT-5844HCL | Recombinant Human GNMT 293 Cell Lysate | +Inquiry |
IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
LACC1-8298HCL | Recombinant Human C13orf31 293 Cell Lysate | +Inquiry |
EXOC4-6510HCL | Recombinant Human EXOC4 293 Cell Lysate | +Inquiry |
ZSCAN20-2006HCL | Recombinant Human ZSCAN20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yojI Products
Required fields are marked with *
My Review for All yojI Products
Required fields are marked with *
0
Inquiry Basket