Recombinant Full Length Cronobacter Sakazakii Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL34395CF |
Product Overview : | Recombinant Full Length Cronobacter sakazakii Bifunctional protein aas(aas) Protein (A7MR36) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cronobacter sakazakii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MVLKFFRWLFRLLFRIQVYGDTGPLTQQRVLITPNHVSFLDGALMALFLPVRPVFAVYTS ISQQWYMRALKPLIDFVPLDPTKPMSVKQLVRLVGEGRPVVIFPEGRISISGSLMKIYEG AGFVAAKSQATVIPVRIEGAELTFFSRLKGLVKRRLFPRISIHILPPTSIPMPDAPKARD RRKMAGEMLHQVMMEARMAARPRETLFEALINAQKRYGESKSCLEDINFKPDTYRSLMMK TLFVGRILDKYSAPREAIGLMLPNASISAAVIFGAVMRGRIPAMMNYTAGVQGLTSAITA AQIKTIFTSRQFLDKGKLWHLSEQITSVRWVFLEDLKGEVTAKDKAWIFAHLLMPRLAQV EQQPEDAALILFTSGSEGNPKGVVHSHKSLLANVEQIRTIADFTADDKFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRVVPELVYDRNCTVIFGTSTFLGHYARFAHPYDFHL VRYVVAGAEKLQESTKQIWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPAM DARLVEVPGIEQGGRLQLKGPNIMKGYLRVENPGVLEAPAAENPQGVSEPGWYDTGDIVA FDEQGFVQIQGRAKRFAKIAGEMVSLEMVESLALAVSPEKMHATAIKHDAAKGEALVLFT TDPELTREKLAQQARSKGVPELAVPRDIRFLKQLPLLGSGKPDFVSLKKLVDQEETHHA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; ESA_00472; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Lon |
UniProt ID | A7MR36 |
◆ Recombinant Proteins | ||
GPX7-5314H | Recombinant Human GPX7 Protein, GST-tagged | +Inquiry |
KRT33A-8834M | Recombinant Mouse KRT33A Protein | +Inquiry |
CERK-508H | Active Recombinant Human CERK, Flag-tagged | +Inquiry |
Hers-961F | Recombinant Fruit fly Hers Protein, His-tagged | +Inquiry |
ACSL6-2966H | Recombinant Human ACSL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
FABP-175C | Native Guinea Pig Fatty acid Binding Protein | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
Lectin-1860W | Active Native Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLITRK6-1390HCL | Recombinant Human SLITRK6 cell lysate | +Inquiry |
REG1A-1364RCL | Recombinant Rat REG1A cell lysate | +Inquiry |
SEMA3B-1981HCL | Recombinant Human SEMA3B 293 Cell Lysate | +Inquiry |
MTNR1A-4071HCL | Recombinant Human MTNR1A 293 Cell Lysate | +Inquiry |
NLGN4X-3808HCL | Recombinant Human NLGN4X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket