Recombinant Full Length Cowpea Mosaic Virus Rna1 Polyprotein Protein, His-Tagged
Cat.No. : | RFL8155CF |
Product Overview : | Recombinant Full Length Cowpea mosaic virus RNA1 polyprotein Protein (P03600) (1156-1866aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cowpea mosaic virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (1156-1866) |
Form : | Lyophilized powder |
AA Sequence : | GAEEYFDFLPAEENVSSGVAMVAGLKQGVYIPLPTKTALVETPSEWHLDTPCDKVPSILV PTDPRIPAQHEGYDPAKSGVSKYSQPMSALDPELLGEVANDVLELWHDCAVDWDDFGEVS LEEALNGCEGVEYMERIPLATSEGFPHILSRNGKEKGKRRFVQGDDCVVSLIPGTTVAKA YEELEASAHRFVPALVGIECPKDEKLPMRKVFDKPKTRCFTILPMEYNLVVRRKFLNFVR FIMANRHRLSCQVGINPYSMEWSRLAARMKEKGNDVLCCDYSSFDGLLSKQVMDVIASMI NELCGGEDQLKNARRNLLMACCSRLAICKNTVWRVECGIPSGFPMTVIVNSIFNEILIRY HYKKLMREQQAPELMVQSFDKLIGLVTYGDDNLISVNAVVTPYFDGKKLKQSLAQGGVTI TDGKDKTSLELPFRRLEECDFLKRTFVQRSSTIWDAPEDKASLWSQLHYVNCNNCEKEVA YLTNVVNVLRELYMHSPREATEFRRKVLKKVSWITSGDLPTLAQLQEFYEYQRQQGGADN NDTCDLLTSVDLLGPPLSFEKEAMHGCKVSEEIVTKNLAYYDFKRKGEDEVVFLFNTLYP QSSLPDGCHSVTWSQGSGRGGLPTQSWMSYNISRKDSNINKIIRTAVSSKKRVIFCARDN MVPVNIVALLCAVRNKLMPTAVSNATLVKVMENAKAFKFLPEEFNFAFSDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cowpea mosaic virus RNA1 polyprotein |
Synonyms | RNA1 polyprotein; B RNA polyprotein; Bottom component polyprotein; Genome polyprotein B; P1 |
UniProt ID | P03600 |
◆ Recombinant Proteins | ||
Gap43-3149M | Recombinant Mouse Gap43 Protein, Myc/DDK-tagged | +Inquiry |
IL16-485H | Active Recombinant Human Interleukin 16 | +Inquiry |
RFL22463EF | Recombinant Full Length Escherichia Coli Putative Inner Membrane Protein Yafu(Yafu) Protein, His-Tagged | +Inquiry |
PTPRJ-206H | Recombinant Human PTPRJ, GST-tagged | +Inquiry |
Efna1-7438R | Active Recombinant Rat Efna1 protein(Met1-His181), His-tagged | +Inquiry |
◆ Native Proteins | ||
AZU1-40H | Native Human Azurocidin | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
Collagen Type I-524B | Native Bovine Collagen Type I Protein, FITC-conjugated | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
A-172-029HCL | Human A-172 Whole Cell Lysate | +Inquiry |
AKT1S1-15HCL | Recombinant Human AKT1S1 lysate | +Inquiry |
RGS2-2378HCL | Recombinant Human RGS2 293 Cell Lysate | +Inquiry |
MSH2-4120HCL | Recombinant Human MSH2 293 Cell Lysate | +Inquiry |
Stomach-478H | Human Stomach Diabetic Disease Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Cowpea mosaic virus RNA1 polyprotein Products
Required fields are marked with *
My Review for All Cowpea mosaic virus RNA1 polyprotein Products
Required fields are marked with *
0
Inquiry Basket