Recombinant Full Length Colicin-5(Cfa) Protein, His-Tagged
Cat.No. : | RFL28019EF |
Product Overview : | Recombinant Full Length Colicin-5(cfa) Protein (Q47500) (1-490aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-490) |
Form : | Lyophilized powder |
AA Sequence : | MDKVTDNSPDVESTESTEGSFPTVGVDTGDTITATLATGTENVGGGGGAFGGASESSAAI HATAKWSTAQLKKHQAEQAARAAAAEAALAKAKSQRDALTQRLKDIVNDALRANAARSPS VTDLAHANNMAMQAEAERLRLAKAEQKAREEAEAAEKALREAERQRDEIARQQAETAHLL AMAEAAEAEKNRQDSLDEEHRAVEVAEKKLAEAKAELAKAESDVQSKQAIVSRVAGELEN AQKSVDVKVTGFPGWRDVQKKLERQLQDKKNEYSSVTNALNSAVSIRDAKKTDVQNAEIK LKEAKDALEKSQVKDSVDTMVGFYQYITEQYGEKYSRIAQDLAEKAKGSKFSSVDEALAA FEKYKNVLDKKISKVDRDAIFNALESVNYDELSKNLTKISKSLKITSRVSFLYDVGSDFK NAIETGNWRPLFVTLEKSAVDVGVAKIVALMFSFIVGVPLGFWGIAIVTGIVSSYIGDDE LNKLNELLGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cfa |
Synonyms | cfa; Colicin-5 |
UniProt ID | Q47500 |
◆ Recombinant Proteins | ||
Cox20-2278M | Recombinant Mouse Cox20 Protein, Myc/DDK-tagged | +Inquiry |
Cd47-5707M | Recombinant Mouse Cd47 Protein (Met1-Ile162), C-His tagged | +Inquiry |
RFL23199XF | Recombinant Full Length Xenopus Laevis Selenoprotein S B(Sels-B) Protein, His-Tagged | +Inquiry |
PRPF19-30592TH | Recombinant Human PRPF19, His-tagged | +Inquiry |
STAT3-29823TH | Active Recombinant Full Length Human STAT3, His-tagged | +Inquiry |
◆ Native Proteins | ||
calc1-8308S | Native Salmon calc1 | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM55A-942HCL | Recombinant Human TMEM55A 293 Cell Lysate | +Inquiry |
SELL-1963HCL | Recombinant Human SELL cell lysate | +Inquiry |
TELO2-1148HCL | Recombinant Human TELO2 293 Cell Lysate | +Inquiry |
DNM1L-6859HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
NRG1-836CCL | Recombinant Canine NRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cfa Products
Required fields are marked with *
My Review for All cfa Products
Required fields are marked with *
0
Inquiry Basket