Recombinant Human PRPF19, His-tagged
Cat.No. : | PRPF19-30592TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 235-504 of Human PRP19 with an N terminal His tag. Predicted mwt: 31 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 235-504 a.a. |
Description : | PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 118 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHP SQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGL SLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFK TLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWT EILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL |
Gene Name | PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | PRPF19 |
Synonyms | PRPF19; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRP19, PRP19/PSO4 homolog (S. cerevisiae); pre-mRNA-processing factor 19; hPSO4; NMP200; nuclear matrix protein NMP200 related to splicing factor PRP19; PSO4; UBOX4; |
Gene ID | 27339 |
mRNA Refseq | NM_014502 |
Protein Refseq | NP_055317 |
MIM | 608330 |
Uniprot ID | Q9UMS4 |
Chromosome Location | 11q12.2 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism-specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem; |
Function | DNA binding; identical protein binding; protein binding; ubiquitin-protein ligase activity; ubiquitin-ubiquitin ligase activity; |
◆ Recombinant Proteins | ||
PRPF19-3441R | Recombinant Rhesus Macaque PRPF19 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPF19-3623R | Recombinant Rhesus monkey PRPF19 Protein, His-tagged | +Inquiry |
PRPF19-5139H | Recombinant Human PRPF19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Prpf19-5145M | Recombinant Mouse Prpf19 Protein, Myc/DDK-tagged | +Inquiry |
PRPF19-152H | Recombinant Human PRPF19, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPF19-2828HCL | Recombinant Human PRPF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPF19 Products
Required fields are marked with *
My Review for All PRPF19 Products
Required fields are marked with *
0
Inquiry Basket