Recombinant Full Length Clostridium Perfringens Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL8520CF |
Product Overview : | Recombinant Full Length Clostridium perfringens Cardiolipin synthase(cls) Protein (Q0TQG9) (1-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium perfringens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-476) |
Form : | Lyophilized powder |
AA Sequence : | MHLFINMIFLINIVFIISIIFIERRNPQTTWAWILILTFLPILGFIIYILFGQNITREKN FKRKILDDKTKQKYLNSFKSHYKLDNISLKYKDLIMMNFNNDNSTYTQRNDIDLYFDANS LFEEMIDEINKAEKFIHMEFYIFKSDEIGKKILQALTKKAKEGVEVKLLVDSIGNSIHKK DIDKLKAAGGDFKIFFPGFCKYINLRINYRNHRKILIIDSKVAFLGGFNIGDEYLGKDKN IGHWRDTHTKIKGLAINDLEGRFLLDWSYANESDLDIDLKKYFINPHSTDLPKKIIGAQI VSSGPDHTEQQIKNGYFKIINSAKKNLFIQTPYFVPDEPMLEALRLAALSGVDVKIMLPG NPDHKFMGWIANSYFESLLNAGAKIYLYEKGFLHAKTIVADSSICSVGTANMDIRSFSLN FESNIFIYNEAISKSMEEQFFKDLKVCTKVTLESFEKRSIISRIGESIIRLVSPLM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; clsD; CPF_1683; Cardiolipin synthase; CL synthase |
UniProt ID | Q0TQG9 |
◆ Native Proteins | ||
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
ALB-38R | Native Rhesus monkey Albumin (ALB) Protein | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM10-2481HCL | Recombinant Human RBM10 293 Cell Lysate | +Inquiry |
C16orf59-8249HCL | Recombinant Human C16orf59 293 Cell Lysate | +Inquiry |
RNF181-1522HCL | Recombinant Human RNF181 cell lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
GB-2601CCL | Recombinant CMV GB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket