Recombinant Full Length Chlamydia Trachomatis Uncharacterized Protein Ct_474 (Ct_474) Protein, His-Tagged
Cat.No. : | RFL2808CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis Uncharacterized protein CT_474 (CT_474) Protein (O84480) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia Trachomatis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MGIEGRGSGAMQSKKTIKWLKQALVLSSIVNILLLLLIYSTVFRKDIYKLRVFPGNLIAK SSRIGKIPEDILERLENASFADLLALLQEERMVFGHPLKSWALGVSIQKYFVDIAPMLTH PLTFIRLKSPERTWLLPDINDQEFTRICQYLLTERFPFSSRGFFRIMVRDCEAGMVDEDV LYRFCHLPEFLYVRSLLFGAEIEAASVASLARMIIQGGEDLFFSLCCLENRQTAISDHQR RCFLKAYVDRQEPLAALLLLVHDADWVLHEFSDSDLQSFIQLLPREAHYTKKFLGCVAQS CRLGILLEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CT_474 |
Synonyms | CT_474; Uncharacterized protein CT_474 |
UniProt ID | O84480 |
◆ Recombinant Proteins | ||
IL22-60Z | Recombinant Zebrafish IL22 Protein, His-tagged | +Inquiry |
RGS5-6843H | Recombinant Human RGS5 protein, GST-tagged | +Inquiry |
MFI2-946M | Recombinant Mouse MFI2 Protein, His-tagged | +Inquiry |
RFL3870PF | Recombinant Full Length Pan Troglodytes Trace Amine-Associated Receptor 1(Taar1) Protein, His-Tagged | +Inquiry |
RFWD3-7548M | Recombinant Mouse RFWD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
IgA-245R | Native Rat Immunoglobulin A | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-301H | Human Liver Membrane Tumor Lysate | +Inquiry |
METTL5-1083HCL | Recombinant Human METTL5 cell lysate | +Inquiry |
ACTR3B-9048HCL | Recombinant Human ACTR3B 293 Cell Lysate | +Inquiry |
C2C12-067MCL | Mouse C2C12 Whole Cell Lysate | +Inquiry |
CCDC78-7748HCL | Recombinant Human CCDC78 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CT_474 Products
Required fields are marked with *
My Review for All CT_474 Products
Required fields are marked with *
0
Inquiry Basket