Recombinant Zebrafish IL22 Protein, His-tagged

Cat.No. : IL22-60Z
Product Overview : Recombinant Zebrafish IL22 Protein, fused to His-tag, was expressed in E. coli.
Availability April 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Zebrafish
Source : E.coli
Tag : His
Description : Acts upstream of or within defense response to Gram-negative bacterium; immune response; and regulation of inflammatory response. Is expressed in several structures, including caudal fin; gill; heart; liver; and pleuroperitoneal region. Orthologous to human IL22 (interleukin 22).
Form : Supplied as a 0.2 μm filtered solution in PBS, 1 mM DTT (pH8.0).
Molecular Mass : ~25 kDa
AA Sequence : MHHHHHHMGDYAKGEKTTTVTYRHDIKAPEPQDALQVSTSRNNGVHKRTDTRIHSSTCDMKCFTLIALLCSCFLSGCARPTPLDSSATWNDLAAMTDTARNEDDHETRLLPYFSHDMLQEEGSCCINARILKYYVNHVLESDEHTDMKYPMIRNVREGLHRVEQELQNHCKHDYSSHPLVKQFKRNYHASAIMDLAAARNKAIGETNTLYHYLFESCTPK
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.13 mg/ml
Gene Name il22 interleukin 22 [ Danio rerio (zebrafish) ]
Official Symbol IL22
Synonyms TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23
Gene ID 553964
mRNA Refseq NM_001020792
Protein Refseq NP_001018628
UniProt ID Q5TLE4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL22 Products

Required fields are marked with *

My Review for All IL22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon