Recombinant Full Length Chicken Transmembrane Protein 237(Tmem237) Protein, His-Tagged
Cat.No. : | RFL-2260GF |
Product Overview : | Recombinant Full Length Chicken Transmembrane protein 237(TMEM237) Protein (F1NVK6) (1-394aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-394) |
Form : | Lyophilized powder |
AA Sequence : | MGKKQVCPPRALPPVPSFCSADDIPLSRPKKRKPKGKTPLDDIVQATVRRQSESSEPLTP EPQDVPPQRKRKKKKVPPDSETSFTQQNTASLFQNGNGVDVPEAEETVVRKQRKRTKKAR PAETHSSNELEVEEDDIIEDEHRRSPDQQPVFAAPTGISQPVSKVFVEKNRRFQAADRAE LIKTTENINVLLDVKSSWTTRDVALSVHRSFRVIGLFTHGFLAGYAVWNIVVIYILAGNQ LTTVSNLLQQYKMLAYPAQSLFYLLLSISTVSAFDRIDLAKASVALRGFLTLDPAALASF LYFTALILSLSQQMTCDRINLYTPPSENGSIWTAGMEEEILQPWIVVNLVVSILVGASWI FLSYRPELDHSEELMFHTEIEEFPQDEREMLKSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM237 |
Synonyms | TMEM237; Transmembrane protein 237 |
UniProt ID | F1NVK6 |
◆ Recombinant Proteins | ||
APOC1-723R | Recombinant Rat APOC1 Protein | +Inquiry |
RPP40-185H | Recombinant Human RPP40 Protein, His-tagged | +Inquiry |
OASL-310H | Recombinant Human OASL Protein, His-tagged | +Inquiry |
ANGPTL8-1699M | Recombinant Mouse ANGPTL8 Protein (16-198 aa), His-tagged | +Inquiry |
ACTA2-7151H | Recombinant Human Actin, Alpha 2, Smooth Muscle, Aorta, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-355S | Native Sheep IgG | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
DDIM-6H | Native Human D-dimer protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZC3H7A-1959HCL | Recombinant Human ZC3H7A cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
CTSZ-1603HCL | Recombinant Human CTSZ cell lysate | +Inquiry |
MEIS2-4372HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
TNIP1-889HCL | Recombinant Human TNIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM237 Products
Required fields are marked with *
My Review for All TMEM237 Products
Required fields are marked with *
0
Inquiry Basket