Recombinant Full Length Chicken Olfactory Receptor-Like Protein Cor3(Cor3) Protein, His-Tagged
Cat.No. : | RFL4002GF |
Product Overview : | Recombinant Full Length Chicken Olfactory receptor-like protein COR3(COR3) Protein (P37069) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIRLISVDLHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERKTISYVGCILQYFSFVLLTTSECLLLAVMAY DRYVAICKPLLYPAIMTKAVCWRLVESLYFLAFLNSLVHTCGLLKLSFCYSNVVNHFFCD ISPLFQISSSSIAISELLVIISGSLFVMSSIIIILISYVFIILTVVMIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRLTATTFGFIDSKAVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COR3 |
Synonyms | COR3; Olfactory receptor-like protein COR3 |
UniProt ID | P37069 |
◆ Recombinant Proteins | ||
RFL11522LF | Recombinant Full Length Lachancea Kluyveri Cytochrome C Oxidase Subunit 3(Cox3) Protein, His-Tagged | +Inquiry |
SDHAF1-7967M | Recombinant Mouse SDHAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM30AA-12044Z | Recombinant Zebrafish TMEM30AA | +Inquiry |
RFL25398TF | Recombinant Full Length Tortula Ruralis Photosystem I Reaction Center Subunit V, Chloroplastic(Psag) Protein, His-Tagged | +Inquiry |
REXO1-14093M | Recombinant Mouse REXO1 Protein | +Inquiry |
◆ Native Proteins | ||
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
COLV-19B | Native Bovine COLV Protein | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIBADH-785HCL | Recombinant Human HIBADH cell lysate | +Inquiry |
GCOM1-5977HCL | Recombinant Human GCOM1 293 Cell Lysate | +Inquiry |
USP1-475HCL | Recombinant Human USP1 293 Cell Lysate | +Inquiry |
DPH3-6836HCL | Recombinant Human DPH3 293 Cell Lysate | +Inquiry |
SH3BP1-1872HCL | Recombinant Human SH3BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COR3 Products
Required fields are marked with *
My Review for All COR3 Products
Required fields are marked with *
0
Inquiry Basket