Recombinant Full Length Chicken Cyclic Nucleotide-Gated Channel Rod Photoreceptor Subunit Alpha Protein, His-Tagged
Cat.No. : | RFL25324GF |
Product Overview : | Recombinant Full Length Chicken Cyclic nucleotide-gated channel rod photoreceptor subunit alpha Protein (Q90980) (1-645aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-645) |
Form : | Lyophilized powder |
AA Sequence : | MKVGVIETHHSHPIIPSVVVQDTSEDPGLIEKGENRFARQWYLPGAFAQYNINNNSNKDE EKKKKKEKKSKSENKKDGERQKNKEKKEKHKNKDKKKGKEEEKKKDIFIIDPAGNMYYNW LFCITMPVMYNWTMIIARACFDELQNDYLAVWFIVDYVSDVIYIADMFVRTRTGYLEQGL LVKEEQKLKEKYKSSLQFKLDFLSIIPTDLLYFKLGLNYPELRINRLLRVARMFEFFQRT ETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGADTWVYPNTSHPEFARLTRK YVYSLYWSTLTLTTIGETPPPVRDSEYFFVVVDFLVGVLIFATIVGNVGSMISNMNAARA EFQAKIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAIN VHLETLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVA DDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEY PDAKAMLEEKGKQILMKDGLLDIEVANLGSDPKDLEEKVAYMEGSMDRLQTKFARLLAEY DAAQQKLKKRLTQIEKILKPVMEQEFLDFEEADPPTDKPGVTKTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cyclic nucleotide-gated channel rod photoreceptor subunit alpha |
Synonyms | Cyclic nucleotide-gated channel rod photoreceptor subunit alpha; CNG channel 3; CNG-3; CNG3 |
UniProt ID | Q90980 |
◆ Recombinant Proteins | ||
NP-634V | Recombinant H7N9 (A/Anhui/1-BALF_RG6/2013) NP Protein, His-tagged | +Inquiry |
SLC35A4-8113Z | Recombinant Zebrafish SLC35A4 | +Inquiry |
IFITM5-4344C | Recombinant Chicken IFITM5 | +Inquiry |
SLC43A2-15450M | Recombinant Mouse SLC43A2 Protein | +Inquiry |
Card10-286M | Recombinant Mouse Card10 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
ERP27-1501HCL | Recombinant Human ERP27 cell lysate | +Inquiry |
PPM1F-2961HCL | Recombinant Human PPM1F 293 Cell Lysate | +Inquiry |
FAM131C-258HCL | Recombinant Human FAM131C lysate | +Inquiry |
ANKMY2-8860HCL | Recombinant Human ANKMY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Cyclic nucleotide-gated channel rod photoreceptor subunit alpha Products
Required fields are marked with *
My Review for All Cyclic nucleotide-gated channel rod photoreceptor subunit alpha Products
Required fields are marked with *
0
Inquiry Basket