Recombinant Full Length Cataglyphis Bombycina Rhodopsin Protein, His-Tagged
Cat.No. : | RFL21390CF |
Product Overview : | Recombinant Full Length Cataglyphis bombycina Rhodopsin Protein (Q17296) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cataglyphis bombycinus (Saharan silver ant) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MMSIASGPSHAAYTWTAQGGGFGNQTVVDKVPPEMLHLVDAHWYQFPPMNPLWHAILGFV IGILGMISVIGNGMVIYIFTTTKSLRTPSNLLVINLAISDFLMMLSMSPAMVINCYYETW VLGPLVCELYGLTGSLFGCGSIWTMTMIAFDRYNVIVKGLSAKPMTINGALLRILGIWFF SLGWTIAPMFGWNRYVPEGNMTACGTDYLTKDLLSRSYILVYSFFCYFLPLFLIIYSYFF IIQAVAAHEKNMREQAKKMNVASLRSAENQSTSAECKLAKVALMTISLWFMAWTPYLVIN YAGIFETVKINPLFTIWGSLFAKANAVYNPIVYGISHPKYRAALFQRFPSLACSSGPAGA DTLSTTTTVTEGTEKPAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cataglyphis bombycina Rhodopsin |
Synonyms | Rhodopsin |
UniProt ID | Q17296 |
◆ Recombinant Proteins | ||
Rapgef4-5378M | Recombinant Mouse Rapgef4 Protein, Myc/DDK-tagged | +Inquiry |
SH-RS07050-5437S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS07050 protein, His-tagged | +Inquiry |
RNF111-14285M | Recombinant Mouse RNF111 Protein | +Inquiry |
ARHGAP40-683M | Recombinant Mouse ARHGAP40 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIA1-1973R | Recombinant Rhesus monkey GRIA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-123M | Mouse Stomach Tissue Lysate (7 Day Old) | +Inquiry |
TBX10-1205HCL | Recombinant Human TBX10 293 Cell Lysate | +Inquiry |
OTX1-3512HCL | Recombinant Human OTX1 293 Cell Lysate | +Inquiry |
CAPZA3-280HCL | Recombinant Human CAPZA3 cell lysate | +Inquiry |
COQ4-385HCL | Recombinant Human COQ4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cataglyphis bombycina Rhodopsin Products
Required fields are marked with *
My Review for All Cataglyphis bombycina Rhodopsin Products
Required fields are marked with *
0
Inquiry Basket