Recombinant Full Length Cat T-Cell Surface Glycoprotein Cd8 Alpha Chain(Cd8A) Protein, His-Tagged
Cat.No. : | RFL13864FF |
Product Overview : | Recombinant Full Length Cat T-cell surface glycoprotein CD8 alpha chain(CD8A) Protein (P41688) (22-239aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Felis catus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-239) |
Form : | Lyophilized powder |
AA Sequence : | AGPSPFRLSPVRVEGRLGQRVELQCEVLLSSAAPGCTWLFQKNEPAARPIFLAYLSRSRTKLAEELDPKQISGQRIQDTLYSLTLHRFRKEEEGYYFCSVVSNSVLYFSAFVPVFLPVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASGLDLSCDIYIWAPLAGTCAFLLLSLVITVICNHRNRRRVCKCPRPVVRAGGKPSPSERYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD8A |
Synonyms | CD8A; T-cell surface glycoprotein CD8 alpha chain; CD antigen CD8a |
UniProt ID | P41688 |
◆ Recombinant Proteins | ||
CD8A-3719Z | Recombinant Zebrafish CD8A | +Inquiry |
CD8A-1158H | Recombinant Human CD8a Protein, His-tagged | +Inquiry |
RFL27560RF | Recombinant Full Length Rat T-Cell Surface Glycoprotein Cd8 Alpha Chain(Cd8A) Protein, His-Tagged | +Inquiry |
CD8A-272H | Recombinant Human CD8A protein, His-tagged | +Inquiry |
CD8A-6744H | Recombinant Human CD8A protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *
0
Inquiry Basket