Recombinant Full Length Carassius Auratus Alpha-2 Adrenergic Receptor Protein, His-Tagged
Cat.No. : | RFL5878CF |
Product Overview : | Recombinant Full Length Carassius auratus Alpha-2 adrenergic receptor Protein (P32251) (1-436aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Carassius auratus (Goldfish) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-436) |
Form : | Lyophilized powder |
AA Sequence : | MDVTQSNATKDDANITVTPWPYTETAAAFIILVVSVIILVSIVGNVLVIVAVLTSRALRA PQNLFLVSLACADILVATLVIPFSLANEIMGYWFFGSTWCAFYLALDVLFCTSSIVHLCA ISLDRYWSVTKAVSYNLKRTPKRIKSMIAVVWVISAVISFPPLIMTKHDEKECLINDETW YILSSSLVSFFAPGFIMITVYCKIYRVAKQRSSTVFVAKNGLERQPSQSETCFVRKDKFE KESPSSNSSESNQRQEELDDIDLEESATSDNKPKSSRFSNRRRVDGARCCPQRTCRISWV SSQEQSSKQLAVASKTKVAQMREKRFTFVLTVVMGVFVLCWFPFFFTYSLHAICGDSCEP PEALFKLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKICLLDCAAHLRDSCLGTLGRLNAK CIFECHQKSNQEETAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Carassius auratus Alpha-2 adrenergic receptor |
Synonyms | Alpha-2 adrenergic receptor; Alpha-2 adrenoreceptor; Alpha-2 adrenoceptor |
UniProt ID | P32251 |
◆ Recombinant Proteins | ||
MSR1-4609H | Recombinant Human MSR1 Protein (Lys77-Leu451), C-His tagged | +Inquiry |
IFNGR1-001H | Recombinant Human IFNGR1 Protein, His-tagged | +Inquiry |
PPM1A-862H | Active Recombinant Human PPM1A Protein, His-tagged | +Inquiry |
RFL25995RF | Recombinant Full Length Rickettsia Akari Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
PVR-3141HF | Recombinant Human PVR Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMM-5666HCL | Recombinant Human GZMM 293 Cell Lysate | +Inquiry |
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
ITGB8-881HCL | Recombinant Human ITGB8 cell lysate | +Inquiry |
TMED6-1023HCL | Recombinant Human TMED6 293 Cell Lysate | +Inquiry |
CHAD-182HCL | Recombinant Human CHAD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Carassius auratus Alpha-2 adrenergic receptor Products
Required fields are marked with *
My Review for All Carassius auratus Alpha-2 adrenergic receptor Products
Required fields are marked with *
0
Inquiry Basket