Recombinant Full Length Capsular Polysaccharide Biosynthesis Protein Cpsc(Cpsc) Protein, His-Tagged
Cat.No. : | RFL26742SF |
Product Overview : | Recombinant Full Length Capsular polysaccharide biosynthesis protein CpsC(cpsC) Protein (Q97SJ6) (1-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-230) |
Form : | Lyophilized powder |
AA Sequence : | MKEQNTIEIDVFQLVKSLWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRN QGDKPGLTNQDLQAGTYLVKDYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDT RIVSISVNDRVPEEASRIANSLREVAAQKIISITRVSDVTTLEEARPAISPSSPNIKRNT LIGFLAGVIGTSVIVLHLELLDTRVKRPEDIENTLQMTLLGVVPNLGKLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cpsC |
Synonyms | cpsC; SP_0348; Capsular polysaccharide biosynthesis protein CpsC |
UniProt ID | Q97SJ6 |
◆ Native Proteins | ||
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
SERPIND1-12H | Native Human Heparin Cofactor II | +Inquiry |
FGG -47P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Appendix-4H | Human Appendix Tissue Lysate | +Inquiry |
LOC155060-2089HCL | Recombinant Human LOC155060 cell lysate | +Inquiry |
Muscles-773C | Chicken S. Muscles Membrane Lysate, Total Protein | +Inquiry |
ATHL1-8619HCL | Recombinant Human ATHL1 293 Cell Lysate | +Inquiry |
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cpsC Products
Required fields are marked with *
My Review for All cpsC Products
Required fields are marked with *
0
Inquiry Basket