Recombinant Full Length Candida Glabrata Palmitoyltransferase Pfa4(Pfa4) Protein, His-Tagged
Cat.No. : | RFL25751CF |
Product Overview : | Recombinant Full Length Candida glabrata Palmitoyltransferase PFA4(PFA4) Protein (Q6FVE6) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLSRSEWLN DWGESLEDFGVDVDVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA4 |
Synonyms | PFA4; CAGL0E02497g; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4 |
UniProt ID | Q6FVE6 |
◆ Recombinant Proteins | ||
Spike-1284V | Recombinant COVID-19 Spike S1 (E484K, F565L, D614G, V1176F) protein(Met1-Arg685), His-tagged | +Inquiry |
COMT-021H | Recombinant Human COMT Protein, His/SUMOpro-tagged | +Inquiry |
DHRS7B-2507Z | Recombinant Zebrafish DHRS7B | +Inquiry |
CYTH4-2043C | Recombinant Chicken CYTH4 | +Inquiry |
Mgll-4060M | Recombinant Mouse Mgll Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIME1-4740HCL | Recombinant Human LIME1 293 Cell Lysate | +Inquiry |
MES-SA-Dx5-1078H | MES-SA/Dx5 (human uterine sarcoma, MDR variant) nuclear extract lysate | +Inquiry |
METTL22-83HCL | Recombinant Human METTL22 lysate | +Inquiry |
MEPCE-4364HCL | Recombinant Human MEPCE 293 Cell Lysate | +Inquiry |
CPBT-56410RH | Rabbit Anti-Human PDCD4 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA4 Products
Required fields are marked with *
My Review for All PFA4 Products
Required fields are marked with *
0
Inquiry Basket