Recombinant Full Length Candida Dubliniensis C-5 Sterol Desaturase(Erg3) Protein, His-Tagged
Cat.No. : | RFL3019CF |
Product Overview : | Recombinant Full Length Candida dubliniensis C-5 sterol desaturase(ERG3) Protein (Q8NJ57) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida dubliniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MDIVLEICDYYLFDKVYADVFPKDGPVHEYLKPAIQSFSEINFPKLQNWDSFDTNSTLIS SNNFNISNVNPATIPGYLLSKIASYQDKSEIYGLAPKFFPATEFIDTSFLSRSNIFREVL SLFIITTLFGWLLYFIVAYLSYVFVFDKKIFNHPRYLKNQMSLEIKRATSAIPVMVLLTI PFFLLELHGYSFLYEEINESTGGYKAILWQIPKFILFTDCGIYFLHRWLHWPSVYKALHK PHHKWIVCTPFASHAFHPVDGFFQSLPYHLYPLLFPLHKVLYLLLFTFVNFWTVMIHDGS YWSNDPVVNGTACHTVHHLYFNYNYGQFTTLWDRLGNSYRRPDDSLFVKDQKKEEEKKIW KEQTRQMEEIRGEVEGKVDDREYIDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG3 |
Synonyms | ERG3; CD36_04520; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase |
UniProt ID | Q8NJ57 |
◆ Recombinant Proteins | ||
KLRK1-5673H | Active Recombinant Human Killer Cell Lectin-Like Receptor Subfamily K, Member 1, Fc-tagged | +Inquiry |
EXPA1-2938M | Recombinant Mouse-ear cress EXPA1 protein(18-250aa), His&Myc-tagged | +Inquiry |
TPT1-6949C | Recombinant Chicken TPT1 | +Inquiry |
NSMF-475H | Recombinant Human NSMF Protein, His-tagged | +Inquiry |
EGFLAM-5047M | Recombinant Mouse EGFLAM Protein | +Inquiry |
◆ Native Proteins | ||
REN-388H | Active Native Human Renin Antigen | +Inquiry |
AEBP1-8321S | Native S. cerevisiae AEBP1 | +Inquiry |
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
URG-94H | Active Native Human Urokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL5-7180HCL | Recombinant Human CUL5 293 Cell Lysate | +Inquiry |
TEX12-663HCL | Recombinant Human TEX12 lysate | +Inquiry |
NDUFA3-3920HCL | Recombinant Human NDUFA3 293 Cell Lysate | +Inquiry |
EDC4-529HCL | Recombinant Human EDC4 cell lysate | +Inquiry |
THUMPD3-1083HCL | Recombinant Human THUMPD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ERG3 Products
Required fields are marked with *
My Review for All ERG3 Products
Required fields are marked with *
0
Inquiry Basket