Recombinant Full Length Candida Albicans Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL1301CF |
Product Overview : | Recombinant Full Length Candida albicans Palmitoyltransferase PFA5(PFA5) Protein (Q59NR8) (1-405aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-405) |
Form : | Lyophilized powder |
AA Sequence : | MIWSKEYLKKNYIKLLVPICVVLVLAYLNYAINYAVGYKLVYVHHSHAVAIILWVLLGFF QLELLVYWVLIFLVGPGKSPVFPPIDLYGENNKGLIPLPDLFFCDEKGFPYYCSNSNSIK LERSFFSKDVGYNVIKFDHYCIWIGQPIGQDNYLFFMKFMMGFLAFFIIVLIYCARFTRE SIQQGEIDHNFIVLFVMSGFWIIMIGCLFGIHLRYVSINMTTLDEITINQRKRYNRWKDA RKNPNMPSWMKTKHPPRKETGRRYVNVKHKTGRAIVRYYIDERPFDMGFRRNWINLVFNG NRNHGKDDEFYTLWRLAAAFVVFIIPFIDIPFSFRGKLQVKDDVEQELHEQENLLAKYTV YSSVVNDKFMNMIDEKLKKNSYSAPGYLVETTPQNNQSTIDKDSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA5 |
Synonyms | PFA5; CAALFM_C501440CA; CaO19.11611; CaO19.4134; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5 |
UniProt ID | Q59NR8 |
◆ Recombinant Proteins | ||
SART3-4077R | Recombinant Rhesus monkey SART3 Protein, His-tagged | +Inquiry |
AGER-268R | Recombinant Rhesus monkey AGER Protein, His-tagged | +Inquiry |
ETS1-159HF | Recombinant Full Length Human ETS1 Protein | +Inquiry |
STAB1-7810Z | Recombinant Zebrafish STAB1 | +Inquiry |
KDR-5143H | Recombinant Human KDR protein, mFc-tagged | +Inquiry |
◆ Native Proteins | ||
TOD-43 | Active Native Tyramine Oxidase | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXO1-6149HCL | Recombinant Human FOXO1 293 Cell Lysate | +Inquiry |
TNNI2-1802HCL | Recombinant Human TNNI2 cell lysate | +Inquiry |
VAT1L-424HCL | Recombinant Human VAT1L 293 Cell Lysate | +Inquiry |
PSME3-2740HCL | Recombinant Human PSME3 293 Cell Lysate | +Inquiry |
TMED7-671HCL | Recombinant Human TMED7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA5 Products
Required fields are marked with *
My Review for All PFA5 Products
Required fields are marked with *
0
Inquiry Basket