Recombinant Full Length Burkholderia Thailandensis Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL33202BF |
Product Overview : | Recombinant Full Length Burkholderia thailandensis Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q2T4B3) (1-653aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia thailandensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-653) |
Form : | Lyophilized powder |
AA Sequence : | MAEPLLQLTRVTRRFPAGDKDVVVLDDVSLSIDAGEIVAIVGASGSGKSTLMNILGCLDH PSSGSYRVGARETSELESDELARLRREHFGFIFQRYHLLPHLSAAENVEMPAVYAGSAQA QRRERALMLLARLGLSDRAGHRPSQLSGGQQQRVSIARALMNGGEVILADEPTGALDSKS GHDVIRVLRELNALGHTVIIVTHDENVAAHARRIIEISDGRIVGDRLNPHADGADAASGA SGDAGPQRARRLSAGVGRFAEAFRMAWIALVSHRLRTLLTMLGIIIGITSVVSIVAIGEG AKRYMLDEIGSIGTNTINVYPGADWGDSRADAIQTLVPADAAALADQIYVDSATPETSRS LLLRYRNIDVNALVSGVGERFFQVRGMKMAQGIAFGPDEVRRQAQVAVIDENTRRKLFGA NPNPLGEVILIDNLPCIVIGVTAAKKSAFGDTKNLNVWVPYTTASGRLFGQRHLDSITVR VRDGQPSAAAEQSLTKLMLQRHGRKDFFTYNMDSVVKTVEKTGQSLTLLLSLIAVISLVV GGIGVMNIMLVSVTERTREIGIRMAVGARQADIMQQFLVEAVTVCLMGGAIGIVLSLGMS FVFSLFVDQWKMVFSAGSIVSAFLCSTLIGVVFGFMPARNASRLDPIDALARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; BTH_II1792; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q2T4B3 |
◆ Recombinant Proteins | ||
LIMS1-2655M | Recombinant Mouse LIMS1 Protein (2-325 aa) | +Inquiry |
DNAJB8-3986HF | Recombinant Full Length Human DNAJB8 Protein, GST-tagged | +Inquiry |
CINP-3672H | Recombinant Human CINP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ROGDI-10328Z | Recombinant Zebrafish ROGDI | +Inquiry |
PPHLN1-2438C | Recombinant Chicken PPHLN1 | +Inquiry |
◆ Native Proteins | ||
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K3-4511HCL | Recombinant Human MAP2K3 293 Cell Lysate | +Inquiry |
SARS2-2060HCL | Recombinant Human SARS2 293 Cell Lysate | +Inquiry |
C14orf177-8279HCL | Recombinant Human C14orf177 293 Cell Lysate | +Inquiry |
PTRH1-1443HCL | Recombinant Human PTRH1 cell lysate | +Inquiry |
NXNL1-1240HCL | Recombinant Human NXNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket