Recombinant Full Length Burkholderia Pseudomallei Translocator Protein Bipb(Bipb) Protein, His-Tagged
Cat.No. : | RFL22002BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Translocator protein BipB(bipB) Protein (A3NLD5) (1-620aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-620) |
Form : | Lyophilized powder |
AA Sequence : | MSSGVQGGPAAHANAYQTHPLRDAASALGTLSPQAYVDVVSAAQRNFLERMSQLASEQCD AQPAAHDARLDDRPALRAPQERDAPPLGASDTGSRASGAAKLTELLGVLMSVISASSLDE LKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQAAAAAKQAGADAKAADAA VDAAQKRYDDAVKQGLPDDQLQSLKAALEQARQQAGDAHGRADALQADATKKLDAASALA TQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAELTAVLGKLQELISSGNVKEL ESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMGCIGKIVGWVITAVSFAAAAF TGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVMDAILKPLMEMISSLITKALVA CGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAVASKVIDAMAGQLTKLMDSAIGK MLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEAKEDGMLLANRFEKAGTVMNVGNQ VSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGDLLKQAVDAFAEHNRVLAQLMQQMS DAGEMQTSTGKLILRNARAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bipB |
Synonyms | bipB; BURPS668_A2162; Translocator protein BipB |
UniProt ID | A3NLD5 |
◆ Recombinant Proteins | ||
RFL14097MF | Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg267 Homolog (Mpn_385) Protein, His-Tagged | +Inquiry |
MCU-6098HF | Recombinant Full Length Human MCU Protein, GST-tagged | +Inquiry |
FGFR3-001H | Recombinant Human FGFR3 Protein, Fc-His-tagged | +Inquiry |
PRPF38B-4719R | Recombinant Rat PRPF38B Protein | +Inquiry |
NSP8/NSP7/NSP12-13S | Recombinant SARS-CoV-2 NSP8_NSP7 and NSP12 Complex Protein, N-14×His tagged | +Inquiry |
◆ Native Proteins | ||
F10-26055TH | Native Human F10 | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Fga -67R | Native Rat Fibrinogen | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
PC-3-015HCL | Human PC-3 Whole Cell Lysate | +Inquiry |
OPA3-3575HCL | Recombinant Human OPA3 293 Cell Lysate | +Inquiry |
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
KLHL13-4912HCL | Recombinant Human KLHL13 293 Cell Lysate | +Inquiry |
SCT-2019HCL | Recombinant Human SCT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All bipB Products
Required fields are marked with *
My Review for All bipB Products
Required fields are marked with *
0
Inquiry Basket