Recombinant Full Length Burkholderia Pseudomallei Bifunctional Protein Glk(Glk) Protein, His-Tagged
Cat.No. : | RFL25017BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Bifunctional protein glk(glk) Protein (Q63RQ7) (1-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-641) |
Form : | Lyophilized powder |
AA Sequence : | MSTGAQTKAAAASQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIR KYLKDAKIGRVNHAAIAIANPVDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALA MALPGLTDAQRVQIGGGARRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAP MDEREDLVLQYARRKYPHVSFERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHA GDALALEAVECFCAILGTFAGNLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKG RFEAYLANIPTYLITAEYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERR VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSN IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAA PNAELAEAMARAKARAGASAGDEAADVLDWLSHGAAPAAKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glk |
Synonyms | glk; BPSL2614; Bifunctional protein glk [Includes: Glucokinase; Glucose kinase; Putative HTH-type transcriptional regulator] |
UniProt ID | Q63RQ7 |
◆ Recombinant Proteins | ||
EHD1-2036R | Recombinant Rat EHD1 Protein | +Inquiry |
IAPP-28H | Recombinant Human IAPP protein, MYC/DDK-tagged | +Inquiry |
GPX5-7233M | Recombinant Mouse GPX5 Protein | +Inquiry |
KIR2DL3-164H | Recombinant Human KIR2DL3 protein, Fc-tagged | +Inquiry |
K48UB2-316H | Recombinant Human K48UB2 Protein | +Inquiry |
◆ Native Proteins | ||
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
Heparin-200S | Active Native Swine Heparin | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
Collagen-58M | Native Mouse Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon descending-101H | Human Descending Colon Membrane Lysate | +Inquiry |
PMFBP1-1382HCL | Recombinant Human PMFBP1 cell lysate | +Inquiry |
NEFL-3884HCL | Recombinant Human NEFL 293 Cell Lysate | +Inquiry |
HPCA-815HCL | Recombinant Human HPCA cell lysate | +Inquiry |
HEPACAM2-1050RCL | Recombinant Rat HEPACAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glk Products
Required fields are marked with *
My Review for All glk Products
Required fields are marked with *
0
Inquiry Basket