Recombinant Full Length Burkholderia Pseudomallei Bifunctional Protein Glk(Glk) Protein, His-Tagged
Cat.No. : | RFL4200BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Bifunctional protein glk(glk) Protein (Q3JPP0) (1-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-641) |
Form : | Lyophilized powder |
AA Sequence : | MSTGAQTKAAAASQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIR KYLKDAKIGRVNHAAIAIANPVDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALA MALPGLTDAQRVQIGGGTRRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAP MDEREDLVLQYARRKYPHVSFERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHA GDALALEAVECFCAILGTFAGNLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKG RFEAYLANIPTYLITAEYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERR VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSN IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAA PNAELAEAMARAKARAGASAGDEAADVLDWLSHGAAPAAKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glk |
Synonyms | glk; BURPS1710b_3090; Bifunctional protein glk [Includes: Glucokinase; Glucose kinase; Putative HTH-type transcriptional regulator] |
UniProt ID | Q3JPP0 |
◆ Recombinant Proteins | ||
SNUPN-5650R | Recombinant Rat SNUPN Protein | +Inquiry |
PPP1R8-26964TH | Recombinant Human PPP1R8 | +Inquiry |
CYP4A1-1404R | Recombinant Rat CYP4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27795MF | Recombinant Full Length Mouse Cytochrome C Oxidase Protein 20 Homolog(Cox20) Protein, His-Tagged | +Inquiry |
CSF1-32H | Active Recombinant Human CSF1, His-tagged | +Inquiry |
◆ Native Proteins | ||
ACTB-882P | Native Porcine ACTB Protein | +Inquiry |
C4A-158H | Native Human C4A protein | +Inquiry |
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
TF-262H | Native Human Transferrin | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA3FP-1089HCL | Recombinant Human TUBA3FP cell lysate | +Inquiry |
TMEM8A-927HCL | Recombinant Human TMEM8A 293 Cell Lysate | +Inquiry |
POP1-3012HCL | Recombinant Human POP1 293 Cell Lysate | +Inquiry |
IAPP-5319HCL | Recombinant Human IAPP 293 Cell Lysate | +Inquiry |
ELMO2-6621HCL | Recombinant Human ELMO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glk Products
Required fields are marked with *
My Review for All glk Products
Required fields are marked with *
0
Inquiry Basket