Recombinant Full Length Buchnera Aphidicola Subsp. Schizaphis Graminum Uncharacterized Membrane Protein Busg_286(Busg_286) Protein, His-Tagged
Cat.No. : | RFL8383BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized membrane protein BUsg_286(BUsg_286) Protein (Q8K9N7) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera Aphidicola Subsp. Schizaphis Graminum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MNFLPFLIAKRLYHRNNKNHAVLLVSILSKIGISISIFTLILSFSALNGFQILIKKNILS SLPHGIIELTNTSAFTWKDITKKLESLPEVIYSEPYVLMNSVLLKNDKMRFINIKSFKNI KYIKKYFSFQKKLYNFSKLKKIYNNEIIISSDLAKYFSLKEGDCINLIILNKKISFDKTQ IQSFSFKVKSIFHSNGISNSNIGLIPFIFFQKFFNIKNNINKIELYMSDPFQADKIILKI AKKIKTPLFFYNWMYSYKYIYHDIKIIKTIIYVTLFLIIIISCFSVISICLTSISKKTKD IAILRSIGANNILIQLIFFYYGMRFIIIGNLIGLLTGIITVLNFKKIMFFLEKHFEENWF LKNVYYKNFLLLQINFFDLIIIFISTLTIGIVANWYPIYYASKINPNKILKEY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BUsg_286 |
Synonyms | BUsg_286; Uncharacterized membrane protein BUsg_286 |
UniProt ID | Q8K9N7 |
◆ Native Proteins | ||
AC-63B | Native Bovine Activated Protein C | +Inquiry |
MFGE8-8518B | Native Bovine MFGE8, Fluoresence-labeled | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCCD1-1217HCL | Recombinant Human TBCCD1 293 Cell Lysate | +Inquiry |
Brain-84M | Mouse Brain Tissue Lysate (7 Days Old) | +Inquiry |
C1orf189-8169HCL | Recombinant Human C1orf189 293 Cell Lysate | +Inquiry |
PDGFC-2872HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
FAM162A-6416HCL | Recombinant Human FAM162A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BUsg_286 Products
Required fields are marked with *
My Review for All BUsg_286 Products
Required fields are marked with *
0
Inquiry Basket