Recombinant Full Length Buchnera Aphidicola Subsp. Acyrthosiphon Pisum Upf0053 Protein Bu323 (Bu323) Protein, His-Tagged
Cat.No. : | RFL9590BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0053 protein BU323 (BU323) Protein (P57408) (1-521aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera aphidicola subsp. Acyrthosiphon pisum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-521) |
Form : | Lyophilized powder |
AA Sequence : | MEFFLDPSTWAGLLTLVILEVVLGIDNLIFVAILSEKLPPNQRDKARLIGLGLALVMRLA LLSLISWIVTLNSPIVHNKFFSLSIRDIILLFGGFFLLFKTTMELHERLENNHHENSENK NYAGFWAVVIQIVVLDAVFSLDAIITAVGMVNQLLIMMIAVILATFLMLLASKALTNFIN LHQTVVVLCLSFLLMIGFSLVTEALRFCIPKGYLYAAIGFSILIEIFNQIARHNFMKNQS RRPMRQRAAEAILRLMVGEQNKKQQIKKIEINSQKTDSIQSSKEMETFKDEERYMINGVL TLAGRSIRSIMTPRSNISWVNTEKNTDEIRMQLLDTPHSLFPVCKGELDEIIGIVRAKEL LVAIEKKIDASTFSSKILPIIIPDTLDPIKLLGVLRRAQGSFVIVSNEFGVVQGLITPLD VLEAIAGEFPDADETPDIIQENNSWLVKGETDLHSLQQLLNTEELIKEDNYASLGGLLIA QKGQLPIPGEIIHIHPFYFHIVKATEYRIDLVRIIKNQDDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BU323 |
Synonyms | BU323; UPF0053 protein BU323 |
UniProt ID | P57408 |
◆ Recombinant Proteins | ||
Ppat-3408R | Recombinant Rat Ppat, His-tagged | +Inquiry |
FAM199X-1599R | Recombinant Rhesus monkey FAM199X Protein, His-tagged | +Inquiry |
KLK5-5792H | Recombinant Human KLK5 protein, His-tagged | +Inquiry |
SYNJ2BP-9846H | Recombinant Human SYNJ2BP, GST-tagged | +Inquiry |
RFL17150EF | Recombinant Full Length Escherichia Coli Ferrous-Iron Efflux Pump Fief(Fief) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
HDL-1539H | Native Human High-density lipoprotein | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
LDH5-8342H | Native Human LDH5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Arabidopsis-9119A | Arabidopsis Thaliana Whole Plant Tissue Lysate | +Inquiry |
NDUFA7-3916HCL | Recombinant Human NDUFA7 293 Cell Lysate | +Inquiry |
TSPAN7-861MCL | Recombinant Mouse TSPAN7 cell lysate | +Inquiry |
FABP5-6476HCL | Recombinant Human FABP5 293 Cell Lysate | +Inquiry |
UBL4A-554HCL | Recombinant Human UBL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BU323 Products
Required fields are marked with *
My Review for All BU323 Products
Required fields are marked with *
0
Inquiry Basket